Peroxisomal multifunctional enzyme type 2 (Hsd17b4) Recombinant Protein | Hsd17b4 recombinant protein
Recombinant Rat Peroxisomal multifunctional enzyme type 2 (Hsd17b4), partial
Gene Names
Hsd17b4; MPF-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Peroxisomal multifunctional enzyme type 2 (Hsd17b4); Recombinant Rat Peroxisomal multifunctional enzyme type 2 (Hsd17b4); partial; Recombinant Rat Peroxisomal multifunctional enzyme type 2 (Hsd17b4) (His tagged); Peroxisomal multifunctional enzyme type 2; MFE-2; 17-beta-hydroxysteroid dehydrogenase 4; 17-beta-HSD 4; D-bifunctional protein; DBP; Multifunctional protein 2; MPF-2; Hsd17b4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-311aa; Partial, provide the (3R)-hydroxyacyl-CoA dehydrogenase chain
Sequence
MASPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSSAADKVVEEIRRRGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHMKKQNYGRIIMTASASGIYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTIAPNAGSRMTETVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRKRNQPMTPEAVRDNWVKICDFSNASKPKSIQESTGGIIEVLHKIDSEGISQNH
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
79,428 Da
NCBI Official Full Name
peroxisomal multifunctional enzyme type 2
NCBI Official Synonym Full Names
hydroxysteroid (17-beta) dehydrogenase 4
NCBI Official Symbol
Hsd17b4
NCBI Official Synonym Symbols
MPF-2
NCBI Protein Information
peroxisomal multifunctional enzyme type 2; DBP; MFE-2; 17-beta-HSD 4; D-bifunctional protein; multifunctional protein 2; 17-beta-hydroxysteroid dehydrogenase 4; peroxisomal multifunctional enzyme type II
UniProt Protein Name
Peroxisomal multifunctional enzyme type 2
UniProt Gene Name
Hsd17b4
UniProt Synonym Gene Names
Edh17b4; MFE-2; 17-beta-HSD 4; DBP; MPF-2
UniProt Entry Name
DHB4_RAT
Similar Products
Product Notes
The Hsd17b4 hsd17b4 (Catalog #AAA961795) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-311aa; Partial, provide the (3R)-hydroxyacyl-CoA dehydrogenase chain. The amino acid sequence is listed below: MASPLRFDGR VVLVTGAGGG LGRAYALAFA ERGALVVVND LGGDFKGVGK GSSAADKVVE EIRRRGGKAV ANYDSVEAGE KLVKTALDTF GRIDVVVNNA GILRDRSFSR ISDEDWDIIQ RVHLRGSFQV TRAAWDHMKK QNYGRIIMTA SASGIYGNFG QANYSAAKLG LLGLANTLVI EGRKNNIHCN TIAPNAGSRM TETVMPEDLV EALKPEYVAP LVLWLCHESC EENGGLFEVG AGWIGKLRWE RTLGAIVRKR NQPMTPEAVR DNWVKICDFS NASKPKSIQE STGGIIEVLH KIDSEGISQN H. It is sometimes possible for the material contained within the vial of "Peroxisomal multifunctional enzyme type 2 (Hsd17b4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
