Estradiol 17-beta-dehydrogenase 2 Recombinant Protein | Hsd17b2 recombinant protein
Estradiol 17-beta-dehydrogenase 2
Gene Names
Hsd17b2; AI194836; AI194967; AI255511
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Estradiol 17-beta-dehydrogenase 2; Hsd17b2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-381aa; full length protein
Sequence
MSPFASESAWLCLAAAAVLGGTLLCGCRSGRQLRSQAVCLAGLWGGACLLSLSLLCTLFLLSVACFLLLYMSSSDQDLLPVDQKAVLVTGADSGFGHGLAKHLDKLGFTVFAGVLDKEGPGAEELRKHCSERLSVLQMDVTKPEQIKDAHSKVTEKIQDKGLWAVVNNAGVFHLPIDGELIPMSIYRKCMAVNFFGTVEVTKAFLPLLRKSKGRLVNVSSMGGTVPLQMTSAYAATKAALTMFSTIIRQELDKWGVKVVTIKPGGFKTNITGSQDIWDKMEKEILDHFSKDIQENYGQDYVHTQKLIIPTLKERSNPDITPVLRDIQHAISARNPSSFYYPGRMAYLWVCLAAYCPTSLLDYVIKKGFYPQPTPRALRTVH
Sequence Length
Full Length Protein
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Hsd17b2 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Hsd17b2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
41,836 Da
NCBI Official Full Name
estradiol 17-beta-dehydrogenase 2
NCBI Official Synonym Full Names
hydroxysteroid (17-beta) dehydrogenase 2
NCBI Official Symbol
Hsd17b2
NCBI Official Synonym Symbols
AI194836; AI194967; AI255511
NCBI Protein Information
estradiol 17-beta-dehydrogenase 2
UniProt Protein Name
Estradiol 17-beta-dehydrogenase 2
Protein Family
UniProt Gene Name
Hsd17b2
UniProt Synonym Gene Names
Edh17b2; 17-beta-HSD 2
UniProt Entry Name
DHB2_MOUSE
Uniprot Description
HSD17B2: Capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH. Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Protein type: Lipid Metabolism - androgen and estrogen; Oxidoreductase; Endoplasmic reticulum; EC 1.1.1.239; EC 1.1.1.62; Membrane protein, integral
Cellular Component: intracellular membrane-bound organelle
Molecular Function: 3-alpha(17-beta)-hydroxysteroid dehydrogenase (NAD+) activity; estradiol 17-beta-dehydrogenase activity
Biological Process: androgen biosynthetic process; estrogen biosynthetic process; in utero embryonic development; placenta development; response to retinoic acid
Research Articles on Hsd17b2
Similar Products
Product Notes
The Hsd17b2 hsd17b2 (Catalog #AAA7042864) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-381aa; full length protein. The amino acid sequence is listed below: MSPFASESAW LCLAAAAVLG GTLLCGCRSG RQLRSQAVCL AGLWGGACLL SLSLLCTLFL LSVACFLLLY MSSSDQDLLP VDQKAVLVTG ADSGFGHGLA KHLDKLGFTV FAGVLDKEGP GAEELRKHCS ERLSVLQMDV TKPEQIKDAH SKVTEKIQDK GLWAVVNNAG VFHLPIDGEL IPMSIYRKCM AVNFFGTVEV TKAFLPLLRK SKGRLVNVSS MGGTVPLQMT SAYAATKAAL TMFSTIIRQE LDKWGVKVVT IKPGGFKTNI TGSQDIWDKM EKEILDHFSK DIQENYGQDY VHTQKLIIPT LKERSNPDIT PVLRDIQHAI SARNPSSFYY PGRMAYLWVC LAAYCPTSLL DYVIKKGFYP QPTPRALRTV H. It is sometimes possible for the material contained within the vial of "Estradiol 17-beta-dehydrogenase 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
