Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

3-hydroxyacyl-CoA dehydrogenase type-2 (HSD17B10) Recombinant Protein | HSD17B10 recombinant protein

Recombinant Bovine 3-hydroxyacyl-CoA dehydrogenase type-2 (HSD17B10)

Gene Names
HSD17B10; HADH2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-hydroxyacyl-CoA dehydrogenase type-2 (HSD17B10); Recombinant Bovine 3-hydroxyacyl-CoA dehydrogenase type-2 (HSD17B10); HSD17B10 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-261, Full length protein
Sequence
AAACRSVKGLVALITGGASGLGLATAERLVGQGATAVLLDLPNSDGETQAKKLGKSCAFAPADVTSEKDVQAALTLAREKFGRVDVAVNCAGIAVASKTYNLKKSQAHTLEDFQRVINVNLIGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPMGIRVMTIAPGLFGTPLLTTLPDKVRNFLASQVPFPSRLGDPAEYAHLVQAIIENSFLNGEVIRLDGAIRMQP
Sequence Length
260
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for HSD17B10 recombinant protein
This gene encodes 3-hydroxyacyl-CoA dehydrogenase type II, a member of the short-chain dehydrogenase
reductase superfamily. The gene product is a mitochondrial protein that catalyzes the oxidation of a wide variety of fatty acids, alcohols, and steroids. The protein has been implicated in the development of Alzheimer s disease, and mutations in the gene are the cause of 2-methyl-3-hydroxybutyryl-CoA dehydrogenase deficiency (MHBD). Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,140 Da
NCBI Official Full Name
3-hydroxyacyl-CoA dehydrogenase type-2
NCBI Official Synonym Full Names
hydroxysteroid 17-beta dehydrogenase 10
NCBI Official Symbol
HSD17B10
NCBI Official Synonym Symbols
HADH2
NCBI Protein Information
3-hydroxyacyl-CoA dehydrogenase type-2
UniProt Protein Name
3-hydroxyacyl-CoA dehydrogenase type-2
UniProt Gene Name
HSD17B10
UniProt Synonym Gene Names
HADH2; Mitochondrial RNase P protein 2

Uniprot Description

Mitochondrial dehydrogenase that catalyzes the beta-oxidation at position 17 of androgens and estrogens and has 3-alpha-hydroxysteroid dehydrogenase activity with androsterone. Catalyzes the third step in the beta-oxidation of fatty acids. Carries out oxidative conversions of 7-alpha-OH and 7-beta-OH bile acids. Also exhibits 20-beta-OH and 21-OH dehydrogenase activities with C21 steroids. By interacting with intracellular amyloid-beta, it may contribute to the neuronal dysfunction associated with Alzheimer disease (AD). Essential for structural and functional integrity of mitochondria.

Similar Products

Product Notes

The HSD17B10 hsd17b10 (Catalog #AAA1183335) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-261, Full length protein. The amino acid sequence is listed below: AAACRSVKGL VALITGGASG LGLATAERLV GQGATAVLLD LPNSDGETQA KKLGKSCAFA PADVTSEKDV QAALTLAREK FGRVDVAVNC AGIAVASKTY NLKKSQAHTL EDFQRVINVN LIGTFNVIRL VAGEMGQNEP DQGGQRGVII NTASVAAFEG QVGQAAYSAS KGGIVGMTLP IARDLAPMGI RVMTIAPGLF GTPLLTTLPD KVRNFLASQV PFPSRLGDPA EYAHLVQAII ENSFLNGEVI RLDGAIRMQP. It is sometimes possible for the material contained within the vial of "3-hydroxyacyl-CoA dehydrogenase type-2 (HSD17B10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.