Heterogeneous nuclear ribonucleoprotein A1 (Hnrnpa1) Recombinant Protein | Hnrnpa1 recombinant protein

Recombinant Mouse Heterogeneous nuclear ribonucleoprotein A1 (Hnrnpa1)

Cat. Num. AAA962749

• Gene Names: Hnrnpa1; Hdp; HDP-1; Hnrpa1; hnRNP A1; hnrnp-A1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Heterogeneous nuclear ribonucleoprotein A1 (Hnrnpa1); Recombinant Mouse Heterogeneous nuclear ribonucleoprotein A1 (Hnrnpa1); Hnrnpa1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-320, Full length protein
• Sequence: MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF
• Sequence Length: 320

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Hnrnpa1 recombinant protein

This gene belongs to the A
B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. This protein has two repeats of quasi-RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. This protein, along with other hnRNP proteins, is exported from the nucleus, probably bound to mRNA, and is immediately re-imported. Its M9 domain acts as both a nuclear localization and nuclear export signal. The encoded protein is involved in the packaging of pre-mRNA into hnRNP particles, transport of poly A+ mRNA from the nucleus to the cytoplasm, and may modulate splice site selection. It is also thought have a primary role in the formation of specific myometrial protein species in parturition. Multiple alternatively spliced transcript variants have been found for this gene but only two transcripts are fully described. These variants have multiple alternative transcription initiation sites and multiple polyA sites.

NCBI and Uniprot Product Information

• NCBI GI #: 6754220
• NCBI GeneID: 15382
• NCBI Accession #: NP_034577.1
• NCBI GenBank Nucleotide #: NM_010447.5
• UniProt Accession #: P49312; P97312; Q3V269
• Molecular Weight: 28,898 Da
• NCBI Official Full Name: heterogeneous nuclear ribonucleoprotein A1 isoform a
• NCBI Official Synonym Full Names: heterogeneous nuclear ribonucleoprotein A1
• NCBI Official Symbol: Hnrnpa1
• NCBI Official Synonym Symbols: Hdp; HDP-1; Hnrpa1; hnRNP A1; hnrnp-A1
• NCBI Protein Information: heterogeneous nuclear ribonucleoprotein A1
• UniProt Protein Name: Heterogeneous nuclear ribonucleoprotein A1
• Protein Family: Heterogeneous nuclear ribonucleoproteins
• UniProt Gene Name: Hnrnpa1
• UniProt Synonym Gene Names: Fli-2; Hnrpa1; Tis; hnRNP A1

Uniprot Description

Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly(A) mRNA from the nucleus to the cytoplasm and may modulate splice site selection (). May bind to specific miRNA hairpins ().