Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RHAG antibody (MBS5300422) used at 1.25 ug/ml to detect target protein.)

Rabbit RHAG Polyclonal Antibody | anti-RHAG antibody

RHAG antibody

Gene Names
RHAG; RH2; Rh50; CD241; RH50A; Rh50GP; SLC42A1
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
RHAG; Polyclonal Antibody; RHAG antibody; Polyclonal RHAG; Anti-RHAG; Rh50; RH2; RH50A; Rh50 GP; Rh-Associated Glycoprotein; anti-RHAG antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
RHAG antibody was raised against the middle region of RHAG
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RHAG antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
409
Applicable Applications for anti-RHAG antibody
Western Blot (WB)
Application Notes
WB: 1.25 ug/ml
Biological Significance
The Rh blood group antigens are associated with human erythrocyte membrane proteins of approximately 30 kDa, the so-called Rh30 polypeptides. Heterogeneously glycosylated membrane proteins of 50 and 45 kDa, the Rh50 glycoproteins, are coprecipitated with the Rh30 polypeptides on immunoprecipitation with anti-Rh-specific mono- and polyclonal antibodies. The Rh antigens appear to exist as a multisubunit complex of CD47, LW, glycophorin B, and play a critical role in the Rh50 glycoprotein.
Cross-Reactivity
Human
Immunogen
RHAG antibody was raised using the middle region of RHAG corresponding to a region with amino acids FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(RHAG antibody (MBS5300422) used at 1.25 ug/ml to detect target protein.)

Western Blot (WB) (RHAG antibody (MBS5300422) used at 1.25 ug/ml to detect target protein.)
Related Product Information for anti-RHAG antibody
Rabbit polyclonal RHAG antibody raised against the middle region of RHAG
Product Categories/Family for anti-RHAG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
45 kDa (MW of target protein)
NCBI Official Full Name
RHAG
NCBI Official Synonym Full Names
Rh-associated glycoprotein
NCBI Official Symbol
RHAG
NCBI Official Synonym Symbols
RH2; Rh50; CD241; RH50A; Rh50GP; SLC42A1
NCBI Protein Information
ammonium transporter Rh type A
UniProt Protein Name
Ammonium transporter Rh type A
Protein Family
UniProt Gene Name
RHAG
UniProt Synonym Gene Names
RH50; Rh50A; Rh family type A glycoprotein; Rh type A glycoprotein
UniProt Entry Name
RHAG_HUMAN

NCBI Description

The protein encoded by this gene is erythrocyte-specific and is thought to be part of a membrane channel that transports ammonium and carbon dioxide across the blood cell membrane. The encoded protein appears to interact with Rh blood group antigens and Rh30 polypeptides. Defects in this gene are a cause of regulator type Rh-null hemolytic anemia (RHN), or Rh-deficiency syndrome.[provided by RefSeq, Mar 2009]

Uniprot Description

RHAG: Associated with rhesus blood group antigen expression. May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane. Defects in RHAG are the cause of regulator type Rh-null hemolytic anemia (RHN); also known as Rh-deficiency syndrome. RHN is a form of chronic hemolytic anemia in which the red blood cells have a stomatocytosis and spherocytosis morphology, an increased osmotic fragility, an altered ion transport system, and abnormal membrane phospholipid organization. Belongs to the ammonium transporter (TC 2.A.49) family. Rh subfamily.

Protein type: Transporter, SLC family; Membrane protein, integral; Transporter; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 6p12.3

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: ammonium transmembrane transporter activity; ankyrin binding

Biological Process: erythrocyte development; bicarbonate transport; cellular ion homeostasis; carbon dioxide transport; transmembrane transport; ammonium transport

Disease: Rh-null, Regulator Type

Research Articles on RHAG

Similar Products

Product Notes

The RHAG rhag (Catalog #AAA5300422) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RHAG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1.25 ug/ml. Researchers should empirically determine the suitability of the RHAG rhag for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RHAG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.