Heterogeneous nuclear ribonucleoprotein A0 (Hnrnpa0) Recombinant Protein | Hnrnpa0 recombinant protein
Recombinant Mouse Heterogeneous nuclear ribonucleoprotein A0 (Hnrnpa0)
Gene Names
Hnrnpa0; Hnrpa0; hnRNP A0; 1110055B05Rik; 3010025E17Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Heterogeneous nuclear ribonucleoprotein A0 (Hnrnpa0); Recombinant Mouse Heterogeneous nuclear ribonucleoprotein A0 (Hnrnpa0); Hnrnpa0 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-305, full length protein
Sequence
MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDLIEHFSQFGAVEKAEIIADKQSGKKRGFGFVYFQSHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIHAGGGGARAARGGRGGGRGRGGGGGGGGRDQNGLAKGGGGGGGGYNSYGGYGGYGAYGGGGGGGGSYGGSDYGNGFGGFGSYSQHQSSYGPMKSGGGGGGGGSWGGRSNSGPYRGGYGGGYGGGSF
Sequence Length
305
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,530 Da
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein A0
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein A0
NCBI Official Symbol
Hnrnpa0
NCBI Official Synonym Symbols
Hnrpa0; hnRNP A0; 1110055B05Rik; 3010025E17Rik
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein A0
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein A0
Protein Family
UniProt Gene Name
Hnrnpa0
UniProt Synonym Gene Names
Hnrpa0; hnRNP A0
Uniprot Description
mRNA-binding component of ribonucleosomes. Specifically binds AU-rich element (ARE)-containing mRNAs. Involved in post-transcriptional regulation of cytokines mRNAs.
Research Articles on Hnrnpa0
Similar Products
Product Notes
The Hnrnpa0 hnrnpa0 (Catalog #AAA1283505) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-305, full length protein. The amino acid sequence is listed below: MENSQLCKLF IGGLNVQTSE SGLRGHFEAF GTLTDCVVVV NPQTKRSRCF GFVTYSNVEE ADAAMAASPH AVDGNTVELK RAVSREDSAR PGAHAKVKKL FVGGLKGDVA EGDLIEHFSQ FGAVEKAEII ADKQSGKKRG FGFVYFQSHD AADKAAVVKF HPIQGHRVEV KKAVPKEDIH AGGGGARAAR GGRGGGRGRG GGGGGGGRDQ NGLAKGGGGG GGGYNSYGGY GGYGAYGGGG GGGGSYGGSD YGNGFGGFGS YSQHQSSYGP MKSGGGGGGG GSWGGRSNSG PYRGGYGGGY GGGSF. It is sometimes possible for the material contained within the vial of "Heterogeneous nuclear ribonucleoprotein A0 (Hnrnpa0), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
