HLA class II histocompatibility antigen, DQ alpha 2 chain Recombinant Protein | HLA-DQA2 recombinant protein

HLA class II histocompatibility antigen, DQ alpha 2 chain

Cat. Num. AAA7042851

• Gene Names: HLA-DQA2; HLA-DXA; DX-ALPHA
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: HLA class II histocompatibility antigen; DQ alpha 2 chain; HLA-DQA2 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 24-255aa; full length protein
• Sequence: EDIVADHVASYGVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSKFPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSELTETLVCALGLSVGLMGIVVGTVFIIQGLRSVGASRHQGLL
• Sequence Length: Full Length Protein

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for HLA-DQA2 recombinant protein

This is a recombinant transmembrane protein expressed in a cell-free expression system.

Product Categories/Family for HLA-DQA2 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 11095447
• NCBI GeneID: 3118
• NCBI Accession #: NP_064440.1
• NCBI GenBank Nucleotide #: NM_020056.4
• UniProt Accession #: P01906; O19789; Q5SQ94; Q5SR04; A2BF37; B0V0E7
• Molecular Weight: 28,033 Da
• NCBI Official Full Name: HLA class II histocompatibility antigen, DQ alpha 2 chain
• NCBI Official Synonym Full Names: major histocompatibility complex, class II, DQ alpha 2
• NCBI Official Symbol: HLA-DQA2
• NCBI Official Synonym Symbols: HLA-DXA; DX-ALPHA
• NCBI Protein Information: HLA class II histocompatibility antigen, DQ alpha 2 chain
• UniProt Protein Name: HLA class II histocompatibility antigen, DQ alpha 2 chain
• Protein Family: HLA class II histocompatibility antigen
• UniProt Gene Name: HLA-DQA2
• UniProt Synonym Gene Names: HLA-DXA
• UniProt Entry Name: DQA2_HUMAN

NCBI Description

This gene belongs to the HLA class II alpha chain family. The encoded protein forms a heterodimer with a class II beta chain. It is located in intracellular vesicles and plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (B lymphocytes, dendritic cells, macrophages) and are used to present antigenic peptides on the cell surface to be recognized by CD4 T-cells. [provided by RefSeq, Jun 2010]

Uniprot Description

HLA-DQA2: Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs, other cells of the gastrointestinal tract, such as epithelial cells, express MHC class II molecules and CD74 and act as APCs, which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen, three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form a heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs, CD74 undergoes a sequential degradation by various proteases, including CTSS and CTSL, leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal miroenvironment has been implicated in the regulation of antigen loading into MHC II molecules, increased acidification produces increased proteolysis and efficient peptide loading. Belongs to the MHC class II family.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: Golgi membrane; lysosomal membrane; plasma membrane; trans-Golgi network membrane

Biological Process: antigen processing and presentation of exogenous peptide antigen via MHC class II; T cell costimulation; T cell receptor signaling pathway