Histone H2B type 1-C/E/F/G/I (HIST1H2BC) Recombinant Protein | HIST1H2BC recombinant protein

Recombinant Human Histone H2B type 1-C/E/F/G/I (HIST1H2BC)

Cat. Num. AAA960676

• Gene Names: HIST1H2BG; H2B/a; H2BFA; H2B.1A; dJ221C16.8
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Histone H2B type 1-C/E/F/G/I (HIST1H2BC); Recombinant Human Histone H2B type 1-C/E/F/G/I (HIST1H2BC); HIST1H2BC recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-126, Full length protein
• Sequence: PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
• Sequence Length: 125

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for HIST1H2BC recombinant protein

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H2B family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.

NCBI and Uniprot Product Information

• NCBI GI #: 4504257
• NCBI GeneID: 8339
• NCBI Accession #: NP_003509.1
• NCBI GenBank Nucleotide #: NM_003518.3
• UniProt Accession #: P62807; P02278; Q3B872; Q4VB69; Q93078; Q93080
• Molecular Weight: 13,906 Da
• NCBI Official Full Name: histone H2B type 1-C/E/F/G/I
• NCBI Official Synonym Full Names: histone cluster 1 H2B family member g
• NCBI Official Symbol: HIST1H2BG
• NCBI Official Synonym Symbols: H2B/a; H2BFA; H2B.1A; dJ221C16.8
• NCBI Protein Information: histone H2B type 1-C/E/F/G/I
• UniProt Protein Name: Histone H2B type 1-C/E/F/G/I
• Protein Family: Histone
• UniProt Gene Name: HIST1H2BC
• UniProt Synonym Gene Names: H2BFL; H2B/a; H2B/g; H2B/h; H2B/k; H2B/l

NCBI Description

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. The protein has antibacterial and antifungal antimicrobial activity. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2B family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq, Aug 2015]

Uniprot Description

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.