Histidine triad nucleotide-binding protein 1 (HINT1) Recombinant Protein | HINT1 recombinant protein

Recombinant Rabbit Histidine triad nucleotide-binding protein 1 (HINT1)

Cat. Num. AAA1233461

• Gene Names: HINT1; HINT
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Histidine triad nucleotide-binding protein 1 (HINT1); Recombinant Rabbit Histidine triad nucleotide-binding protein 1 (HINT1); HINT1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-126aa; Full Length of Mature Protein
• Sequence: ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG
• Sequence Length: 126

• Species: Rabbit
• Production Note: Special Offer: The Mammalian-Cell host-expressed protein is manufactured from a stock plasmid containing the protein gene. Mammalian-Cellhost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Mammalian-Cell host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Mammalian-Cell host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

NCBI and Uniprot Product Information

• NCBI GI #: 130500231
• NCBI GeneID: 100009302
• NCBI Accession #: NP_001076092.1
• NCBI GenBank Nucleotide #: NM_001082623.1
• UniProt Accession #: P80912
• Molecular Weight: 17.6 kDa
• NCBI Official Full Name: histidine triad nucleotide-binding protein 1
• NCBI Official Symbol: HINT1
• NCBI Official Synonym Symbols: HINT
• NCBI Protein Information: histidine triad nucleotide-binding protein 1
• UniProt Protein Name: Histidine triad nucleotide-binding protein 1
• Protein Family: Adenylylsulfatase
• UniProt Gene Name: HINT1
• UniProt Synonym Gene Names: HINT

Uniprot Description

Functions as enzyme, and as scaffolding protein that modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex and by the complex formed with MITF and CTNNB1. Modulates p53/TP53 levels and p53/TP53-mediated apoptosis. Modulates proteasomal degradation of target proteins by the SCF (SKP2-CUL1-F-box protein) E3 ubiquitin-protein ligase complex (). Hydrolyzes purine nucleotide phosphoramidates, including adenosine 5'monophosphoramidate (AMP-NH2), adenosine 5'monophosphomorpholidate (AMP-morpholidate) and guanosine 5'monophosphomorpholidate (GMP-morpholidate). Hydrolyzes lysyl-AMP (AMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) generated by lysine tRNA ligase, lysyl-GMP (GMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) and AMP-N-alanine methyl ester. Can also convert adenosine 5'-O-phosphorothioate and guanosine 5'-O-phosphorothioate to the corresponding nucleoside 5'-O-phosphates with concomitant release of hydrogen sulfide.