CD32b (FcgR2b) Active Protein | CD32 active protein

Human CD32b Recombinant (FcgR2b)

Cat. Num. AAA553152

• Purity: >95%, as determined by SDS-PAGE and HPLC
• Synonyms: CD32b (FcgR2b); Human CD32b Recombinant (FcgR2b); Human CD32b Recombinant (Fcg RIIb) ; Human CD32b Recombinant (Fcgamma RIIb) ; cd32; cd-32; fcgr3a; CD32 active protein

• Host: HEk293 Cells
• Purity/Purification: >95%, as determined by SDS-PAGE and HPLC
• Form/Format: Recombinant CD32b is supplied as a lyophilized 0.2 um filtered PBS solution, pH7.2.
• Sequence Positions: 43-217
• Sequence: TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP
• Sequence Length: 217

• Domain: Ig-like C2
• Host Note: Optimized DNA sequence encoding Human extracellular domain of human CD32b including a C-terminal 6His tag was expressed in HEK293 cells.
• Biological Activity: The activity was determined by the ability to bind human IgG2 with a linear range of 0.1-6 ug/ml
• Immunogen: The sequence for this product protein spans the extracellular domain of the human CD32B precursor, amino acids 43-217
• Endotoxin: Endotoxin content was assayed using a LAL gel clot method.; Endotoxin level was found to be less than 0.1 ng/ug (1EU/ug).
• Reconstitution: A quick spin of the vial followed by reconstitution in distilled water to a concentration not less than 0.1 mg/mL.
• Molecular Weight Note: Recombinant CD32b is a monomer protein consisting of 183 amino acid residue subunits, due to glycosylation migrates as an approximately 30 kDa protein on SDS-PAGE.
• Preparation and Storage: Recombinant CD32b, as supplied, can be stored in working aliquots at 2 degree - 8 degree C for one month, or at -20 degree C to -70 degree C for twelve months.; ; Avoid repeated freeze/thaw cycles.

Related Product Information for CD32 active protein

Human CD32B (FcγRIIB), the low-affinity inhibitory Fcγ receptor (FcγR), is highly homologous in its extracellular domain to CD32A (FcγRIIA), an activating FcγR.CD32B is coexpressed with activating Fc receptors on monocytes, macrophages, basophils and mast cells. CD32B is also expressed by B lymphocytes, the sole FcγR expressed by these cells, where it functions by countering B- cell receptor (BCR) -induced activation.

Product Categories/Family for CD32 active protein

Receptors CD

References

• CD32b expression reflects phenotypic and functional heterogeneity in multiple myeloma (mm) .Blood (ASH Annual Meeting Abstracts), Nov 2008; 112: 842.
• CD32b is highly expressed on clonal plasma cells from patients with systemic light-chain amyloidosis and provides a target for monoclonal antibody–based therapy .Blood, Apr 2008; 111: 3403 - 3406.
• an fc-optimized monoclonal antibody against CD32b, the human inhibitory fc- receptor iib, in the immunotherapy of b-cell malignanacy. .Blood (ASH Annual Meeting Abstracts), Nov 2006; 108: 2529.
• CD32b on clonal plasma cells in systemic light-chain amyloidosis (al) and multiple myeloma (mm) : a target for immunotherapy in both disorders and a prognostic marker in mm. .Blood (ASH Annual Meeting Abstracts), Nov 2006; 108: 3489.