Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human IL-1 alpha/IL1A/IL1F1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 21 kDa.)

IL-1 alpha/IL1A/IL1F1 Active Protein | IL1A active protein

Recombinant Human IL-1 alpha/IL1A/IL1F1 Protein

Gene Names
IL1A; IL1; IL-1A; IL1F1; IL1-ALPHA; IL-1 alpha
Purity
>95% by SDS-PAGE.
Synonyms
IL-1 alpha/IL1A/IL1F1; Recombinant Human IL-1 alpha/IL1A/IL1F1 Protein; IL-1A; IL1; IL1-ALPHA; IL1F1; IL1A active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Sequence Length
271
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is typically 0.2-1 ng/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human IL-1 alpha/IL1A/IL1F1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 21 kDa.)

SDS-Page (Recombinant Human IL-1 alpha/IL1A/IL1F1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 21 kDa.)
Related Product Information for IL1A active protein
Description: Recombinant Human IL-1 alpha/IL1A/IL1F1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ser113-Ala271) of human IL-1 alpha/IL1A/IL1F1 (Accession #NP_000566.3) fused with a 6xHis tag at the C-terminus.

Background: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease.
Product Categories/Family for IL1A active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interleukin-1 alpha
NCBI Official Synonym Full Names
interleukin 1 alpha
NCBI Official Symbol
IL1A
NCBI Official Synonym Symbols
IL1; IL-1A; IL1F1; IL1-ALPHA; IL-1 alpha
NCBI Protein Information
interleukin-1 alpha
UniProt Protein Name
Interleukin-1 alpha
Protein Family
UniProt Gene Name
IL1A
UniProt Synonym Gene Names
IL1F1; IL-1 alpha
UniProt Entry Name
IL1A_HUMAN

NCBI Description

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease. [provided by RefSeq, Jul 2008]

Uniprot Description

IL1A: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. Belongs to the IL-1 family.

Protein type: Motility/polarity/chemotaxis; Cytokine

Chromosomal Location of Human Ortholog: 2q14

Cellular Component: extracellular space; extracellular region; cytosol

Molecular Function: protein binding; interleukin-1 receptor binding; copper ion binding; cytokine activity

Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of mitosis; apoptosis; positive regulation of interleukin-2 biosynthetic process; cytokine and chemokine mediated signaling pathway; germ cell programmed cell death; positive regulation of JNK cascade; fever; negative regulation of cell proliferation; cell proliferation; connective tissue replacement during inflammatory response; positive regulation of angiogenesis; response to copper ion; positive regulation of transcription from RNA polymerase II promoter; immune response; inflammatory response; positive regulation of cytokine secretion

Research Articles on IL1A

Similar Products

Product Notes

The IL1A il1a (Catalog #AAA9139695) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: SAPFSFLSNV KYNFMRIIKY EFILNDALNQ SIIRANDQYL TAAALHNLDE AVKFDMGAYK SSKDDAKITV ILRISKTQLY VTAQDEDQPV LLKEMPEIPK TITGSETNLL FFWETHGTKN YFTSVAHPNL FIATKQDYWV CLAGGPPSIT DFQILENQA. It is sometimes possible for the material contained within the vial of "IL-1 alpha/IL1A/IL1F1, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.