Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human IGFBP-1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 29 kDa.)

IGFBP-1 active protein

Recombinant Human IGFBP-1 Protein

Gene Names
IGFBP1; AFBP; IBP1; PP12; IGF-BP25; hIGFBP-1
Purity
>97% by SDS-PAGE.
Synonyms
IGFBP-1; Recombinant Human IGFBP-1 Protein; AFBP; IBP1; IGF-BP25; PP12; hIGFBP-1; IGFBP-1 active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
APWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
Sequence Length
259
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its ability to inhibit the biological activity of IGF-I on MCF-7 human breast cancer cells. The ED50 for this effect is typically 0.1-0.6 ug/mL in the presence of 6 ng/mL recombinant human IGF-I.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human IGFBP-1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 29 kDa.)

SDS-Page (Recombinant Human IGFBP-1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 29 kDa.)
Related Product Information for IGFBP-1 active protein
Description: Recombinant Human IGFBP-1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala26-Asn259) of human IGFBP-1 (Accession #NP_000587.1) fused with a 6xHis tag at the C-terminus.

Background: The superfamily of insulin-like growth factor (IGF) binding proteins include the six high-affinity IGF binding proteins (IGFBP) and at least four additional low-affinity binding proteins referred to as IGFBP related proteins (IGFBP-rP). All IGFBP superfamily members are cysteine-rich proteins with conserved cysteine residues, which are clustered in the amino- and carboxy-terminal thirds of the molecule. IGFBPs modulate the biological activities of IGF proteins. Some IGFBPs may also have intrinsic bioactivity that is independent of their ability to bind IGF proteins. Post-transitional modifications of IGFBP, including glycosylation, phosphorylation and proteolysis, have been shown to modify the affinities of the binding proteins to IGF.
Product Categories/Family for IGFBP-1 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Insulin-like growth factor-binding protein 1
NCBI Official Synonym Full Names
insulin like growth factor binding protein 1
NCBI Official Symbol
IGFBP1
NCBI Official Synonym Symbols
AFBP; IBP1; PP12; IGF-BP25; hIGFBP-1
NCBI Protein Information
insulin-like growth factor-binding protein 1
UniProt Protein Name
Insulin-like growth factor-binding protein 1
UniProt Gene Name
IGFBP1
UniProt Synonym Gene Names
IBP1; IBP-1; IGF-binding protein 1; IGFBP-1; PP12
UniProt Entry Name
IBP1_HUMAN

NCBI Description

This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP N-terminal domain and a thyroglobulin type-I domain. The encoded protein, mainly expressed in the liver, circulates in the plasma and binds both insulin-like growth factors (IGFs) I and II, prolonging their half-lives and altering their interaction with cell surface receptors. This protein is important in cell migration and metabolism. Low levels of this protein may be associated with impaired glucose tolerance, vascular disease and hypertension in human patients. [provided by RefSeq, Aug 2017]

Uniprot Description

IGFBP1: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 7p12.3

Cellular Component: extracellular space; extracellular region

Molecular Function: insulin-like growth factor binding; insulin-like growth factor I binding; insulin-like growth factor II binding

Biological Process: cellular protein metabolic process; regulation of insulin-like growth factor receptor signaling pathway; unfolded protein response, activation of signaling protein activity; unfolded protein response; tissue regeneration; insulin receptor signaling pathway; signal transduction; positive regulation of cell growth

Research Articles on IGFBP-1

Similar Products

Product Notes

The IGFBP-1 igfbp1 (Catalog #AAA9141702) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: APWQCAPCSA EKLALCPPVS ASCSEVTRSA GCGCCPMCAL PLGAACGVAT ARCARGLSCR ALPGEQQPLH ALTRGQGACV QESDASAPHA AEAGSPESPE STEITEEELL DNFHLMAPSE EDHSILWDAI STYDGSKALH VTNIKKWKEP CRIELYRVVE SLAKAQETSG EEISKFYLPN CNKNGFYHSR QCETSMDGEA GLCWCVYPWN GKRIPGSPEI RGDPNCQIYF NVQN. It is sometimes possible for the material contained within the vial of "IGFBP-1, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.