IGFBP-1 active protein

Recombinant Human IGFBP-1 Protein

Cat. Num. AAA9141702

• Gene Names: IGFBP1; AFBP; IBP1; PP12; IGF-BP25; hIGFBP-1
• Purity: >97% by SDS-PAGE.
• Synonyms: IGFBP-1; Recombinant Human IGFBP-1 Protein; AFBP; IBP1; IGF-BP25; PP12; hIGFBP-1; IGFBP-1 active protein

• Host: HEK293 Cells
• Purity/Purification: >97% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
• Sequence: APWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
• Sequence Length: 259

• Species: Human
• Endotoxin: < 0.1 EU/ug of the protein by LAL method.
• Biological Activity: Measured by its ability to inhibit the biological activity of IGF-I on MCF-7 human breast cancer cells. The ED50 for this effect is typically 0.1-0.6 ug/mL in the presence of 6 ng/mL recombinant human IGF-I.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
• Tag: 6xHis tag at the C-terminus
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human IGFBP-1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 29 kDa.)

Related Product Information for IGFBP-1 active protein

Description: Recombinant Human IGFBP-1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala26-Asn259) of human IGFBP-1 (Accession #NP_000587.1) fused with a 6xHis tag at the C-terminus.

Background: The superfamily of insulin-like growth factor (IGF) binding proteins include the six high-affinity IGF binding proteins (IGFBP) and at least four additional low-affinity binding proteins referred to as IGFBP related proteins (IGFBP-rP). All IGFBP superfamily members are cysteine-rich proteins with conserved cysteine residues, which are clustered in the amino- and carboxy-terminal thirds of the molecule. IGFBPs modulate the biological activities of IGF proteins. Some IGFBPs may also have intrinsic bioactivity that is independent of their ability to bind IGF proteins. Post-transitional modifications of IGFBP, including glycosylation, phosphorylation and proteolysis, have been shown to modify the affinities of the binding proteins to IGF.

Product Categories/Family for IGFBP-1 active protein

Cytokines & Cytokine Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 124055
• NCBI GeneID: 3484
• UniProt Accession #: P08833
• NCBI Official Full Name: Insulin-like growth factor-binding protein 1
• NCBI Official Synonym Full Names: insulin like growth factor binding protein 1
• NCBI Official Symbol: IGFBP1
• NCBI Official Synonym Symbols: AFBP; IBP1; PP12; IGF-BP25; hIGFBP-1
• NCBI Protein Information: insulin-like growth factor-binding protein 1
• UniProt Protein Name: Insulin-like growth factor-binding protein 1
• UniProt Gene Name: IGFBP1
• UniProt Synonym Gene Names: IBP1; IBP-1; IGF-binding protein 1; IGFBP-1; PP12
• UniProt Entry Name: IBP1_HUMAN

NCBI Description

This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP N-terminal domain and a thyroglobulin type-I domain. The encoded protein, mainly expressed in the liver, circulates in the plasma and binds both insulin-like growth factors (IGFs) I and II, prolonging their half-lives and altering their interaction with cell surface receptors. This protein is important in cell migration and metabolism. Low levels of this protein may be associated with impaired glucose tolerance, vascular disease and hypertension in human patients. [provided by RefSeq, Aug 2017]

Uniprot Description

IGFBP1: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 7p12.3

Cellular Component: extracellular space; extracellular region

Molecular Function: insulin-like growth factor binding; insulin-like growth factor I binding; insulin-like growth factor II binding

Biological Process: cellular protein metabolic process; regulation of insulin-like growth factor receptor signaling pathway; unfolded protein response, activation of signaling protein activity; unfolded protein response; tissue regeneration; insulin receptor signaling pathway; signal transduction; positive regulation of cell growth