Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

ES1 protein homolog, mitochondrial Recombinant Protein | C21orf33 recombinant protein

Recombinant human ES1 protein homolog, mitochondrial

Gene Names
C21orf33; ES1; HES1; KNPH; KNPI; GT335
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ES1 protein homolog; mitochondrial; Recombinant human ES1 protein homolog; mitochondrial protein; C21orf33 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
ARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for C21orf33 recombinant protein
ES1 protein homolog, mitochondrial protein
References
[1] "Isolation and characterization of GT335, a novel human gene conserved in Escherichia coli and mapping to 21q22.3."

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52 KD
NCBI Official Full Name
Homo sapiens chromosome 21 open reading frame 33 (C21orf33), nuclear gene encoding mitochondrial protein, transcript variant 1, mRNA
NCBI Official Synonym Full Names
chromosome 21 open reading frame 33
NCBI Official Symbol
C21orf33
NCBI Official Synonym Symbols
ES1; HES1; KNPH; KNPI; GT335
NCBI Protein Information
ES1 protein homolog, mitochondrial; Keio novel protein I; human HES1 protein, homolog to E.coli and zebrafish ES1 protein
UniProt Protein Name
ES1 protein homolog, mitochondrial
Protein Family
UniProt Gene Name
C21orf33
UniProt Synonym Gene Names
HES1; KNPI
UniProt Entry Name
ES1_HUMAN

NCBI Description

This gene encodes a potential mitochondrial protein that is a member of the DJ-1/PfpI gene family. This protein is overexpressed in fetal Down syndrome brain. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]

Uniprot Description

Subcellular location: Mitochondrion

Potential.

Tissue specificity: Ubiquitous, but strongly expressed in heart and skeletal muscle.

Sequence similarities: Belongs to the ES1 family.

Research Articles on C21orf33

Similar Products

Product Notes

The C21orf33 c21orf33 (Catalog #AAA717159) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: ARVALVLSGC GVYDGTEIHE ASAILVHLSR GGAEVQIFAP DVPQMHVIDH TKGQPSEGES RNVLTESARI ARGKITDLAN LSAANHDAAI FPGGFGAAKN LSTFAVDGKD CKVNKEVERV LKEFHQAGKP IGLCCIAPVL AAKVLRGVEV TVGHEQEEGG KWPYAGTAEA IKALGAKHCV KEVVEAHVDQ KNKVVTTPAF MCETALHYIH DGIGAMVRKV LELTGK. It is sometimes possible for the material contained within the vial of "ES1 protein homolog, mitochondrial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.