Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human CST6 Protein was determined by SDS-PAGE with Coomassie Blue, showing bands at 13&17 kDa.)

CST6 active protein

Recombinant Human CST6 Protein

Gene Names
CST6; ECTD15
Purity
>95% by SDS-PAGE.
Synonyms
CST6; Recombinant Human CST6 Protein; cystatin 6; Cystatin E/M; cystatin M; cystatin M/E; Cystatin-6; cystatin-E; cystatin-M; cysteine proteinase inhibitor; CST6 active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
RPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM
Sequence Length
149
Species
Human
Endotoxin
< 0.01 EU/ug of the protein by LAL method.
Biological Activity
Measured by its ability to inhibit papain cleavage of a fluorogenic peptide substrate Z-FR-AMC. The IC50 value is approximately 7.0 nM.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human CST6 Protein was determined by SDS-PAGE with Coomassie Blue, showing bands at 13&17 kDa.)

SDS-Page (Recombinant Human CST6 Protein was determined by SDS-PAGE with Coomassie Blue, showing bands at 13&17 kDa.)
Related Product Information for CST6 active protein
Description: Recombinant Human CST6 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Arg29-Met149) of human CST6 (Accession #NP_001314.1) fused with a 6xHis tag at the C-terminus.

Background: Cystatin E/M encoded by the CST6 gene is a member of family 2 of the cystatin superfamily. It inhibits papain and cathepsin B, two of the cysteine proteases. Its mRNA was found in many tissues by the two groups who did initial cloning. However, its protein was found only in skin and sweat glands by a third group. In addition to being a cysteine protease inhibitor, cystatin E/M is also a substrate for transglutaminases. It is required for viability and for correct formation of cornified layers in the epidermis and hair follicles, as ichq mice, with a null mutation in the cystatin E/M gene, have defects in epidermal cornification and die between 5 and 12 days of age. Cystatin E/M expression and function may not be limited to cutaneous epithelia. For example, it is found in rat brain and is induced during neuronal cell differentiation.
Product Categories/Family for CST6 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
cystatin-M
NCBI Official Synonym Full Names
cystatin E/M
NCBI Official Symbol
CST6
NCBI Official Synonym Symbols
ECTD15
NCBI Protein Information
cystatin-M
UniProt Protein Name
Cystatin-M
Protein Family
UniProt Gene Name
CST6
UniProt Entry Name
CYTM_HUMAN

NCBI Description

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. This gene encodes a cystatin from the type 2 family, which is down-regulated in metastatic breast tumor cells as compared to primary tumor cells. Loss of expression is likely associated with the progression of a primary tumor to a metastatic phenotype. [provided by RefSeq, Jul 2008]

Uniprot Description

CST6: Shows moderate inhibition of cathepsin B but is not active against cathepsin C. Belongs to the cystatin family.

Protein type: Secreted; Motility/polarity/chemotaxis; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: cornified envelope

Molecular Function: cysteine protease inhibitor activity

Biological Process: anatomical structure morphogenesis; epidermis development

Research Articles on CST6

Similar Products

Product Notes

The CST6 cst6 (Catalog #AAA9141700) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: RPQERMVGEL RDLSPDDPQV QKAAQAAVAS YNMGSNSIYY FRDTHIIKAQ SQLVAGIKYF LTMEMGSTDC RKTRVTGDHV DLTTCPLAAG AQQEKLRCDF EVLVVPWQNS SQLLKHNCVQ M. It is sometimes possible for the material contained within the vial of "CST6, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.