Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human CEACAM3/CD66d Protein was determined by SDS-PAGE with Coomassie Blue, showing bands approximately 18-23 kDa.)

CEACAM3/CD66d Active Protein | CEACAM3 active protein

Recombinant Human CEACAM3/CD66d Protein

Gene Names
CEACAM3; CEA; CGM1; W264; W282; CD66D
Purity
>92% by SDS-PAGE.
Synonyms
CEACAM3/CD66d; Recombinant Human CEACAM3/CD66d Protein; CD66D; CEA; CGM1; W264; W282; CEACAM3 active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>92% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
Sequence Length
252
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. When Recombinant Human CEACAM3/CD66d is immobilized at 2 ug/mL (100 uL/well), the concentration of Recombinant Human CEACAM-7 that produces 50% of the optimal binding response is 0.6-3.6 ug/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human CEACAM3/CD66d Protein was determined by SDS-PAGE with Coomassie Blue, showing bands approximately 18-23 kDa.)

SDS-Page (Recombinant Human CEACAM3/CD66d Protein was determined by SDS-PAGE with Coomassie Blue, showing bands approximately 18-23 kDa.)
Related Product Information for CEACAM3 active protein
Description: Recombinant Human CEACAM3/CD66d Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gly155) of human CEACAM3/CD66d (Accession #NP_001806.2) fused with a 6xHis tag at the C-terminus.

Background: The protein encodes a member of the family of carcinoembryonic antigen-related cell adhesion molecules (CEACAMs), which are used by several bacterial pathogens to bind and invade host cells. The encoded transmembrane protein directs phagocytosis of several bacterial species that is dependent on the small GTPase Rac. It is thought to serve an important role in controlling human-specific pathogens by the innate immune system. Alternatively spliced transcript variants have been described.
Product Categories/Family for CEACAM3 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Carcinoembryonic antigen-related cell adhesion molecule 3
NCBI Official Synonym Full Names
CEA cell adhesion molecule 3
NCBI Official Symbol
CEACAM3
NCBI Official Synonym Symbols
CEA; CGM1; W264; W282; CD66D
NCBI Protein Information
carcinoembryonic antigen-related cell adhesion molecule 3
UniProt Protein Name
Carcinoembryonic antigen-related cell adhesion molecule 3
UniProt Gene Name
CEACAM3
UniProt Synonym Gene Names
CD66D; CGM1
UniProt Entry Name
CEAM3_HUMAN

NCBI Description

This gene encodes a member of the family of carcinoembryonic antigen-related cell adhesion molecules (CEACAMs), which are used by several bacterial pathogens to bind and invade host cells. The encoded transmembrane protein directs phagocytosis of several bacterial species that is dependent on the small GTPase Rac. It is thought to serve an important role in controlling human-specific pathogens by the innate immune system. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2013]

Uniprot Description

CEACAM3: Major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, including Neissiria, Moxarella and Haemophilus species, thus playing an important role in the clearance of pathogens by the innate immune system. Responsible for RAC1 stimulation in the course of pathogen phagocytosis. Interacts with S100A9/calprotectin. This interaction is calcium-dependent, but independent of CEACAM3 phosphorylation. CGM1a, the predominant CGM1 transcript, is granulocyte-specific. Not detected out of the granulocytic lineage, such as monocytes, lymphocytes, spleen, testis, colon, brain, liver, pancreas, thymus, ovary, placenta, skeletal muscle, prostate, small intestine, heart, lung and kidney. Belongs to the immunoglobulin superfamily. CEA family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Immunoglobulin superfamily; Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: integral to membrane

Research Articles on CEACAM3

Similar Products

Product Notes

The CEACAM3 ceacam3 (Catalog #AAA9139728) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MGPPSASPHR ECIPWQGLLL TASLLNFWNP PTTAKLTIES MPLSVAEGKE VLLLVHNLPQ HLFGYSWYKG ERVDGNSLIV GYVIGTQQAT PGAAYSGRET IYTNASLLIQ NVTQNDIGFY TLQVIKSDLV NEEATGQFHV YQENAPGLPV GAVAG. It is sometimes possible for the material contained within the vial of "CEACAM3/CD66d, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.