Hemagglutinin-esterase (HE) Recombinant Protein | HE recombinant protein
Recombinant Puffinosis coronavirus Hemagglutinin-esterase (HE)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hemagglutinin-esterase (HE); Recombinant Puffinosis coronavirus Hemagglutinin-esterase (HE); HE recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
25-439aa; full length protein
Sequence
FNEPLNVVSHLSDDWFLFGDSRSDCSYVENNGHPAFDWLDLPQELCHSGKISAKSGNSLF KSFHFTDWYNYTGEGDQVIFYEGVNFSPSHGFKCLAEGDNKRWMGNKARFYALVYKKMAY YRSLSFVNVSYSYGGKAKPTAICKDNTLTLNNPTFISKESNYVDYYYESDANFTLEGCDE FIVPLCVFNGHSRGSSSDPANKYYMDSQMYYNMDTGVFYGFNSTLDVGNTAQNPGLDLTC IYYALTPGNYKAVSLEYLLTIPSKAICLRKPKRFMPVQVVDSRWNNAKHSDNMTAVACQT PYCLFRNTSSGYNGSTHDVHHGGFHFRKLLSGLLYNVSCIAQQGAFFYNNVSSQWPVLGY GQCPTAANIEFIAPVCLYDPLPVILLGVLLGIAVLIIVFLLFYFMTDSGVRLHEA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Puffinosis coronavirus (PV) (Puffinosis virus)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for HE recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
49,180 Da
NCBI Official Full Name
Hemagglutinin-esterase
UniProt Protein Name
Hemagglutinin-esterase
Protein Family
UniProt Gene Name
HE
UniProt Synonym Gene Names
HE protein
UniProt Entry Name
HEMA_CVPV
Uniprot Description
Structural protein that makes short spikes at the surface of the virus. Contains receptor binding and receptor-destroying activities. Mediates de-O-acetylation of N-acetyl-4-O-acetylneuraminic acid, which is probably the receptor determinant recognized by the virus on the surface of erythrocytes and susceptible cells. This receptor-destroying activity is important for virus release as it probably helps preventing self-aggregation and ensures the efficient spread of the progeny virus from cell to cell. May serve as a secondary viral attachment protein for initiating infection, the spike protein being the major one. Seems to be a 'luxury' protein that is not absolutely necessary for virus infection in culture. However, its presence in the virus may alter its pathogenicity. May become a target for both the humoral and the cellular branches of the immune system.
Similar Products
Product Notes
The HE he (Catalog #AAA7016571) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-439aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the HE he for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FNEPLNVVSH LSDDWFLFGD SRSDCSYVEN NGHPAFDWLD LPQELCHSGK ISAKSGNSLF KSFHFTDWYN YTGEGDQVIF YEGVNFSPSH GFKCLAEGDN KRWMGNKARF YALVYKKMAY YRSLSFVNVS YSYGGKAKPT AICKDNTLTL NNPTFISKES NYVDYYYESD ANFTLEGCDE FIVPLCVFNG HSRGSSSDPA NKYYMDSQMY YNMDTGVFYG FNSTLDVGNT AQNPGLDLTC IYYALTPGNY KAVSLEYLLT IPSKAICLRK PKRFMPVQVV DSRWNNAKHS DNMTAVACQT PYCLFRNTSS GYNGSTHDVH HGGFHFRKLL SGLLYNVSCI AQQGAFFYNN VSSQWPVLGY GQCPTAANIE FIAPVCLYDP LPVILLGVLL GIAVLIIVFL LFYFMTDSGV RLHEA. It is sometimes possible for the material contained within the vial of "Hemagglutinin-esterase (HE), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
