SDS-PAGE
Histone deacetylase HDT3 (HDT3) Recombinant Protein | HDT3 recombinant protein
Recombinant Arabidopsis thaliana Histone deacetylase HDT3 (HDT3)
Gene Names
HD2C; F17C15.160; F17C15_160; HDT3; histone deacetylase 2C; HISTONE DEACETYLASE 3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Histone deacetylase HDT3 (HDT3); Recombinant Arabidopsis thaliana Histone deacetylase HDT3 (HDT3); HDT3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-294, Full length protein
Sequence
MEFWGVEVKNGKPLHLDPGLDRLVHISQVALGESKNNVTEPIQLYVTVGSDKLLIGTLSHEKFPQLSTEIVLERNFALSHTWKNGSVFFSGYKVDASDPEPEDLIDDQLEAAGFKAAPKSAAKQVNFQLPNEDVKAKQDDDADGSEEDSSDDDDSENSGDEEEEKVTAESDSEEDDSSDDEEDDSSEEETPKKPEEPKKRSAEPNSSKNPASNKKAKFVTPQKTDSKKPHVHVATPHPSKQAGKNSGGGSTGETSKQQQTPKSAGAFGCKSCTRTFTSEMGLQSHTKAKHSAAA
Sequence Length
294
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
31,830 Da
NCBI Official Full Name
histone deacetylase 2C
NCBI Official Symbol
HD2C
NCBI Official Synonym Symbols
F17C15.160; F17C15_160; HDT3; histone deacetylase 2C; HISTONE DEACETYLASE 3
NCBI Protein Information
histone deacetylase 2C
UniProt Protein Name
Histone deacetylase HDT3
Protein Family
UniProt Gene Name
HDT3
UniProt Synonym Gene Names
HD2C
NCBI Description
HD2-type histone deacetylase HDAC. Involved in the ABA and stress responses. Mediates transcriptional repression
Uniprot Description
Probably mediates the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Involved in the modulation of abscisic acid and stress-responsive genes.
Research Articles on HDT3
Similar Products
Product Notes
The HDT3 hdt3 (Catalog #AAA1424096) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-294, Full length protein. The amino acid sequence is listed below: MEFWGVEVKN GKPLHLDPGL DRLVHISQVA LGESKNNVTE PIQLYVTVGS DKLLIGTLSH EKFPQLSTEI VLERNFALSH TWKNGSVFFS GYKVDASDPE PEDLIDDQLE AAGFKAAPKS AAKQVNFQLP NEDVKAKQDD DADGSEEDSS DDDDSENSGD EEEEKVTAES DSEEDDSSDD EEDDSSEEET PKKPEEPKKR SAEPNSSKNP ASNKKAKFVT PQKTDSKKPH VHVATPHPSK QAGKNSGGGS TGETSKQQQT PKSAGAFGCK SCTRTFTSEM GLQSHTKAKH SAAA. It is sometimes possible for the material contained within the vial of "Histone deacetylase HDT3 (HDT3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
