Hyaluronan synthase 2 (Has2) Recombinant Protein | Has2 recombinant protein

Recombinant Mouse Hyaluronan synthase 2 (Has2), partial

Cat. Num. AAA7055024

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Hyaluronan synthase 2 (Has2); Recombinant Mouse Hyaluronan synthase 2 (Has2); partial; Hyaluronate synthase 2Hyaluronic acid synthase 2 ; HA synthase 2; Has2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 67-374aa; Cytoplasmic Domain
• Sequence: EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHL
• Sequence Length: 552

• Species: Mus musculus (Mouse)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for Has2 recombinant protein

Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most Extracellular domain matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction and it is particularly responsible for the synthesis of high molecular mass hyaluronan. Required for the transition of endocardial cushion cells into mesenchymal cells, a process crucial for heart development. May also play a role in vasculogenesis. High molecular mass hyaluronan also play a role in early contact inhibition a process which stops cell growth when cells come into contact with each other or the Extracellular domain matrix.

References

Disruption of hyaluronan synthase-2 abrogates normal cardiac morphogenesis and hyaluronan-mediated transformation of epithelium to mesenchyme.Camenisch T.D., Spicer A.P., Brehm-Gibson T., Biesterfeldt J., Augustine M.L., Calabro A. Jr., Kubalak S., Klewer S.E., McDonald J.A.J. Clin. Invest. 106:349-360(2000)

NCBI and Uniprot Product Information

• NCBI GI #: 160358868
• NCBI GeneID: 15117
• NCBI Accession #: NP_032242.3
• NCBI GenBank Nucleotide #: NM_008216.3
• UniProt Accession #: P70312; P70411; Q62405; Q68EF7
• Molecular Weight: 51.9 kDa
• NCBI Official Full Name: hyaluronan synthase 2
• NCBI Official Synonym Full Names: hyaluronan synthase 2
• NCBI Official Symbol: Has2
• NCBI Protein Information: hyaluronan synthase 2
• UniProt Protein Name: Hyaluronan synthase 2
• Protein Family: Hyaluronan synthase
• UniProt Gene Name: Has2
• UniProt Synonym Gene Names: HA synthase 2

Uniprot Description

Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction and it is particularly responsible for the synthesis of high molecular mass hyaluronan. Required for the transition of endocardial cushion cells into mesenchymal cells, a process crucial for heart development. May also play a role in vasculogenesis. High molecular mass hyaluronan also play a role in early contact inhibition a process which stops cell growth when cells come into contact with each other or the extracellular matrix.