Putative gustatory receptor 22e (Gr22e) Recombinant Protein | Gr22e recombinant protein
Recombinant Drosophila melanogaster Putative gustatory receptor 22e (Gr22e)
Gene Names
Gr22e; CG31936; DmelCG31936; GR22e; Gr2940.1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative gustatory receptor 22e (Gr22e); Recombinant Drosophila melanogaster Putative gustatory receptor 22e (Gr22e); Gr22e recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-389aa; full length protein
Sequence
MFRPSGSGYRQKWTGLTLKGALYGSWILGVFPFAYDSWTRTLRRSKWLIAYGFVLNAAFI LLVVTNDTESETPLRMEVFHRNALAEQINGIHDIQSLSMVSIMLLRSFWKSGDIERTLNE LEDLQHRYFRNYSLEECISFDRFVLYKGFSVVLELVSMLVLELGMSPNYSAQFFIGLGSL CLMLLAVLLGASHFHLAVVFVYRYVWIVNRELLKLVNKMAIGETVESERMDLLLYLYHRL LDLGQRLASIYDYQMVMVMVSFLIANVLGIYFFIIYSISLNKSLDFKILVFVQALVINML DFWLNVEICELAERTGRQTSTILKLFNDIENIDEKLERSITDFALFCSHRRLRFHHCGLF YVNYEMGFRMAITSFLYLLFLIQFDYWNL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Gr22e recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,560 Da
NCBI Official Full Name
gustatory receptor 22e
NCBI Official Synonym Full Names
Gustatory receptor 22e
NCBI Official Symbol
Gr22e
NCBI Official Synonym Symbols
CG31936; DmelCG31936; GR22e; Gr2940.1
NCBI Protein Information
CG31936 gene product from transcript CG31936-RA
UniProt Protein Name
Gustatory receptor for bitter taste 22e
Protein Family
UniProt Gene Name
Gr22e
UniProt Entry Name
GR22E_DROME
Uniprot Description
Gustatory receptor which mediates acceptance or avoidance behavior, depending on its substrates. Seems to be involved in the sensing of bitter taste since it is expressed in neurons that mediate sensitivity to bitter compounds which are also avoidance-type taste neurons.
Similar Products
Product Notes
The Gr22e gr22e (Catalog #AAA7016304) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-389aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Gr22e gr22e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MFRPSGSGYR QKWTGLTLKG ALYGSWILGV FPFAYDSWTR TLRRSKWLIA YGFVLNAAFI LLVVTNDTES ETPLRMEVFH RNALAEQING IHDIQSLSMV SIMLLRSFWK SGDIERTLNE LEDLQHRYFR NYSLEECISF DRFVLYKGFS VVLELVSMLV LELGMSPNYS AQFFIGLGSL CLMLLAVLLG ASHFHLAVVF VYRYVWIVNR ELLKLVNKMA IGETVESERM DLLLYLYHRL LDLGQRLASI YDYQMVMVMV SFLIANVLGI YFFIIYSISL NKSLDFKILV FVQALVINML DFWLNVEICE LAERTGRQTS TILKLFNDIE NIDEKLERSI TDFALFCSHR RLRFHHCGLF YVNYEMGFRM AITSFLYLLF LIQFDYWNL. It is sometimes possible for the material contained within the vial of "Putative gustatory receptor 22e (Gr22e), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
