Ovarian cancer G-protein coupled receptor 1 (Gpr68) Recombinant Protein | Gpr68 recombinant protein
Recombinant Mouse Ovarian cancer G-protein coupled receptor 1 (Gpr68)
Gene Names
Gpr68; Ogr1; BB131428
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ovarian cancer G-protein coupled receptor 1 (Gpr68); Recombinant Mouse Ovarian cancer G-protein coupled receptor 1 (Gpr68); Gpr68 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-365aa; full length protein
Sequence
MGNITTENSSLSCPIDHTIHQTLAPVVYVTVLVVGFPANCLSLYFGYLQIKARNELGVYL CNLTIADLFYICSLPFWLQYVLQHDDWSHGDLSCQVCGILLYENIYISVGFLCCISIDRY LAVAHPFRFHQFRTLKAAVGVSVLIWAKELLTSIYFLNHKEVIEDEDQHRVCFEHYPIQA WQRSINYYRFLVGFLFPICLLLASYQGILRAVRRSHGTQKSRKDQIQRLVLSTVVIFLAC FLPYHVLLLVRSLWERNCEFAKSIFNVYHFSLLLTSFNCVADPVLYCFVSETTHRDLARL RGACLAVLTCSRTSRAREAYPLGAPEASGKSGAQGEEPELLTKLHSAFQTPSSLGVGGPS TVGLA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Gpr68 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
41,209 Da
NCBI Official Full Name
ovarian cancer G-protein coupled receptor 1
NCBI Official Synonym Full Names
G protein-coupled receptor 68
NCBI Official Symbol
Gpr68
NCBI Official Synonym Symbols
Ogr1; BB131428
NCBI Protein Information
ovarian cancer G-protein coupled receptor 1
UniProt Protein Name
Ovarian cancer G-protein coupled receptor 1
Protein Family
UniProt Gene Name
Gpr68
UniProt Synonym Gene Names
Ogr1
UniProt Entry Name
OGR1_MOUSE
Uniprot Description
GPR68: Proton-sensing receptor involved in pH homeostasis. May represents an osteoblastic pH sensor regulating cell-mediated responses to acidosis in bone. Mediates its action by association with G proteins that stimulates inositol phosphate (IP) production or Ca(2+) mobilization. The receptor is almost silent at pH 7.8 but fully activated at pH 6.8. Function also as a metastasis suppressor gene in prostate cancer. Belongs to the G-protein coupled receptor 1 family.
Protein type: Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 1; Receptor, GPCR; Tumor suppressor
Cellular Component: integral to membrane; membrane; plasma membrane
Molecular Function: G-protein coupled receptor activity; signal transducer activity
Biological Process: G-protein coupled receptor protein signaling pathway; negative regulation of monocyte differentiation; positive regulation of insulin secretion; signal transduction
Research Articles on Gpr68
Similar Products
Product Notes
The Gpr68 gpr68 (Catalog #AAA7016246) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-365aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Gpr68 gpr68 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGNITTENSS LSCPIDHTIH QTLAPVVYVT VLVVGFPANC LSLYFGYLQI KARNELGVYL CNLTIADLFY ICSLPFWLQY VLQHDDWSHG DLSCQVCGIL LYENIYISVG FLCCISIDRY LAVAHPFRFH QFRTLKAAVG VSVLIWAKEL LTSIYFLNHK EVIEDEDQHR VCFEHYPIQA WQRSINYYRF LVGFLFPICL LLASYQGILR AVRRSHGTQK SRKDQIQRLV LSTVVIFLAC FLPYHVLLLV RSLWERNCEF AKSIFNVYHF SLLLTSFNCV ADPVLYCFVS ETTHRDLARL RGACLAVLTC SRTSRAREAY PLGAPEASGK SGAQGEEPEL LTKLHSAFQT PSSLGVGGPS TVGLA. It is sometimes possible for the material contained within the vial of "Ovarian cancer G-protein coupled receptor 1 (Gpr68), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
