Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 (GPIHBP1) Recombinant Protein | GPIHBP1 recombinant protein

Recombinant Human Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 (GPIHBP1)

Gene Names
GPIHBP1; HYPL1D; GPI-HBP1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 (GPIHBP1); Recombinant Human Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 (GPIHBP1); GPIHBP1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
21-184aa; full length protein
Sequence
QTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLT QNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPP WQSSRVQDPTGKGAGGPRGSSETVGAALLLNLLAGLGAMGARRP
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for GPIHBP1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,806 Da
NCBI Official Full Name
glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 isoform 2
NCBI Official Synonym Full Names
glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1
NCBI Official Symbol
GPIHBP1
NCBI Official Synonym Symbols
HYPL1D; GPI-HBP1
NCBI Protein Information
glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1
UniProt Protein Name
Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1
UniProt Gene Name
GPIHBP1
UniProt Synonym Gene Names
HBP1; GPI-HBP1; GPI-anchored HDL-binding protein 1
UniProt Entry Name
HDBP1_HUMAN

NCBI Description

This gene encodes a capillary endothelial cell protein that facilitates the lipolytic processing of triglyceride-rich lipoproteins. The encoded protein is a glycosylphosphatidylinositol-anchored protein that is a member of the lymphocyte antigen 6 (Ly6) family. This protein plays a major role in transporting lipoprotein lipase (LPL) from the subendothelial spaces to the capillary lumen. Mutations in this gene are the cause of hyperlipoproteinemia, type 1D. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2014]

Uniprot Description

GPIHBP1: Plays a key role in the lipolytic processing of chylomicrons.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: anchored to external side of plasma membrane; apical plasma membrane; basolateral plasma membrane; external side of plasma membrane; intracellular

Molecular Function: high-density lipoprotein binding; lipid binding; protein transmembrane transporter activity

Biological Process: cholesterol homeostasis; intracellular protein transport; lipid transport; positive regulation of lipoprotein lipase activity; protein import; protein stabilization; transcytosis

Disease: Hyperlipoproteinemia, Type Id

Research Articles on GPIHBP1

Similar Products

Product Notes

The GPIHBP1 gpihbp1 (Catalog #AAA7016041) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-184aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the GPIHBP1 gpihbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QTQQEEEEED EDHGPDDYDE EDEDEVEEEE TNRLPGGRSR VLLRCYTCKS LPRDERCNLT QNCSHGQTCT TLIAHGNTES GLLTTHSTWC TDSCQPITKT VEGTQVTMTC CQSSLCNVPP WQSSRVQDPT GKGAGGPRGS SETVGAALLL NLLAGLGAMG ARRP. It is sometimes possible for the material contained within the vial of "Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 (GPIHBP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.