Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

G-protein coupled estrogen receptor 1 (Gper) Recombinant Protein | Gper recombinant protein

Recombinant Rat G-protein coupled estrogen receptor 1 (Gper)

Gene Names
Gper; GPR41; Gpr30
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
G-protein coupled estrogen receptor 1 (Gper); Recombinant Rat G-protein coupled estrogen receptor 1 (Gper); Recombinant G-protein coupled estrogen receptor 1 (Gper); G-protein coupled estrogen receptor 1; Chemoattractant receptor-like 2 G-protein coupled receptor 30 G-protein coupled receptor 41 Membrane estrogen receptor; mER; Gper recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-375
Sequence
MAATTPAQDVGVEIYLGPVWPAPSNSTPLALNLSLALREDAPGNLTGDLSEHQQYVIALFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAAADLILVADSLIEVFNLDEQYYDIAVLCTFMSLFLQINMYSSVFFLTWMSFDRYLALAKAMRCGLFRTKHHARLSCGLIWMASVSATLVPFTAVHLRHTEEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRALIRAHRHRGLRPRRQKALRMIFAVVLVFFICWLPENVFISVHLLQWAQPGDTPCKQSFRHAYPLTGHIVNLAAFSNSCLSPLIYSFLGETFRDKLRLYVAQKTSLPALNRFCHATLKAVIPDSTEQSDVKFSSAV
Sequence Length
375
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,260 Da
NCBI Official Full Name
G-protein coupled estrogen receptor 1
NCBI Official Synonym Full Names
G protein-coupled estrogen receptor 1
NCBI Official Symbol
Gper
NCBI Official Synonym Symbols
GPR41; Gpr30
NCBI Protein Information
G-protein coupled estrogen receptor 1; mER; chemokine receptor-like 2; membrane estrogen receptor; G protein-coupled receptor 30; G-protein coupled receptor 30; G-protein coupled receptor 41; chemoattractant receptor-like 2
UniProt Protein Name
G-protein coupled estrogen receptor 1
UniProt Gene Name
Gper
UniProt Synonym Gene Names
Cmkrl2; Gpr30; Gpr41; mER
UniProt Entry Name
GPER_RAT

NCBI Description

an orphan G protein-coupled receptor found in lung [RGD, Feb 2006]

Uniprot Description

GPER1: Receptor for estrogen. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Motility/polarity/chemotaxis; Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass

Cellular Component: Golgi apparatus; basolateral plasma membrane; dendrite; early endosome; integral to membrane; nuclear envelope; trans-Golgi network; cytosol; postsynaptic membrane; recycling endosome; perinuclear region of cytoplasm; keratin filament; cytoplasm; dendritic shaft; intracellular; endoplasmic reticulum membrane; cytoplasmic vesicle membrane; endoplasmic reticulum; postsynaptic density; Golgi membrane; presynaptic membrane; axon; mitochondrial membrane; presynaptic active zone; plasma membrane; nerve terminal; cell junction; nucleus

Molecular Function: G-protein coupled receptor activity; estrogen receptor activity; hormone binding; steroid hormone receptor activity; drug binding; chromatin binding; mineralocorticoid receptor activity; steroid binding

Biological Process: positive regulation of apoptosis; generation of action potential; nuclear fragmentation during apoptosis; positive regulation of caspase activity; positive regulation of vasodilation; negative regulation of DNA metabolic process; positive regulation of neurotransmitter secretion; negative regulation of leukocyte activation; negative regulation of cell proliferation; elevation of cytosolic calcium ion concentration; positive regulation of MAPKKK cascade; positive regulation of epidermal growth factor receptor signaling pathway; positive regulation of cell proliferation; positive regulation of cAMP biosynthetic process; inflammatory response; steroid hormone receptor signaling pathway; positive regulation of neurogenesis; cytosolic calcium ion homeostasis; negative regulation of lipid biosynthetic process; positive regulation of insulin secretion; positive regulation of inositol trisphosphate biosynthetic process; negative regulation of fat cell differentiation; apoptotic chromosome condensation; positive regulation of phosphoinositide 3-kinase cascade; mineralocorticoid receptor signaling pathway; negative regulation of inflammatory response; positive regulation of G-protein coupled receptor protein signaling pathway; innate immune response; positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling; positive regulation of protein amino acid phosphorylation; positive regulation of release of sequestered calcium ion into cytosol; positive regulation of cell migration

Research Articles on Gper

Similar Products

Product Notes

The Gper gper (Catalog #AAA1120624) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-375. The amino acid sequence is listed below: MAATTPAQDV GVEIYLGPVW PAPSNSTPLA LNLSLALRED APGNLTGDLS EHQQYVIALF LSCLYTIFLF PIGFVGNILI LVVNISFREK MTIPDLYFIN LAAADLILVA DSLIEVFNLD EQYYDIAVLC TFMSLFLQIN MYSSVFFLTW MSFDRYLALA KAMRCGLFRT KHHARLSCGL IWMASVSATL VPFTAVHLRH TEEACFCFAD VREVQWLEVT LGFIVPFAII GLCYSLIVRA LIRAHRHRGL RPRRQKALRM IFAVVLVFFI CWLPENVFIS VHLLQWAQPG DTPCKQSFRH AYPLTGHIVN LAAFSNSCLS PLIYSFLGET FRDKLRLYVA QKTSLPALNR FCHATLKAVI PDSTEQSDVK FSSAV. It is sometimes possible for the material contained within the vial of "G-protein coupled estrogen receptor 1 (Gper), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.