Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Aspartate aminotransferase, mitochondrial (GOT2) Recombinant Protein | GOT2 recombinant protein

Recombinant Human Aspartate aminotransferase, mitochondrial (GOT2)

Gene Names
GOT2; KAT4; KATIV; KYAT4; mitAAT
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Aspartate aminotransferase; mitochondrial (GOT2); Recombinant Human Aspartate aminotransferase; GOT2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
30-430, Full length protein
Sequence
SSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK
Sequence Length
401
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for GOT2 recombinant protein
Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,030 Da
NCBI Official Full Name
aspartate aminotransferase, mitochondrial isoform 2
NCBI Official Synonym Full Names
glutamic-oxaloacetic transaminase 2
NCBI Official Symbol
GOT2
NCBI Official Synonym Symbols
KAT4; KATIV; KYAT4; mitAAT
NCBI Protein Information
aspartate aminotransferase, mitochondrial
UniProt Protein Name
Aspartate aminotransferase, mitochondrial
UniProt Gene Name
GOT2
UniProt Synonym Gene Names
mAspAT; FABP-1; FABPpm

NCBI Description

Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2013]

Uniprot Description

Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids.

Research Articles on GOT2

Similar Products

Product Notes

The GOT2 got2 (Catalog #AAA964909) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 30-430, Full length protein. The amino acid sequence is listed below: SSWWTHVEMG PPDPILGVTE AFKRDTNSKK MNLGVGAYRD DNGKPYVLPS VRKAEAQIAA KNLDKEYLPI GGLAEFCKAS AELALGENSE VLKSGRFVTV QTISGTGALR IGASFLQRFF KFSRDVFLPK PTWGNHTPIF RDAGMQLQGY RYYDPKTCGF DFTGAVEDIS KIPEQSVLLL HACAHNPTGV DPRPEQWKEI ATVVKKRNLF AFFDMAYQGF ASGDGDKDAW AVRHFIEQGI NVCLCQSYAK NMGLYGERVG AFTMVCKDAD EAKRVESQLK ILIRPMYSNP PLNGARIAAA ILNTPDLRKQ WLQEVKVMAD RIIGMRTQLV SNLKKEGSTH NWQHITDQIG MFCFTGLKPE QVERLIKEFS IYMTKDGRIS VAGVTSSNVG YLAHAIHQVT K. It is sometimes possible for the material contained within the vial of "Aspartate aminotransferase, mitochondrial (GOT2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.