Proton-gated ion channel (glvI) Recombinant Protein | glvI recombinant protein
Recombinant Gloeobacter violaceus Proton-gated ion channel (glvI)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Proton-gated ion channel (glvI); Recombinant Gloeobacter violaceus Proton-gated ion channel (glvI); glvI recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
44-359aa; full length protein
Sequence
QDMVSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGV RVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPF DSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLE SKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNIL VETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPV VFLLANIILAFLFFGF
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Gloeobacter violaceus (strain PCC 7421)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for glvI recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,986 Da
NCBI Official Full Name
hypothetical protein glr4197
NCBI Official Symbol
glr4197
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Proton-gated ion channel
Protein Family
UniProt Gene Name
glvI
UniProt Synonym Gene Names
LGIC
UniProt Entry Name
GLIC_GLOVI
Uniprot Description
Cationic channel with similar permeabilities for Na+ and K+, that is activated by an increase of the proton concentration on the extracellular side. Displays no permeability for chloride ions. Shows slow kinetics of activation, no desensitization and a single channel conductance of 8 pS. Might contribute to adaptation to external pH change.
Research Articles on glvI
Similar Products
Product Notes
The glvI glvi (Catalog #AAA7015902) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 44-359aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the glvI glvi for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QDMVSPPPPI ADEPLTVNTG IYLIECYSLD DKAETFKVNA FLSLSWKDRR LAFDPVRSGV RVKTYEPEAI WIPEIRFVNV ENARDADVVD ISVSPDGTVQ YLERFSARVL SPLDFRRYPF DSQTLHIYLI VRSVDTRNIV LAVDLEKVGK NDDVFLTGWD IESFTAVVKP ANFALEDRLE SKLDYQLRIS RQYFSYIPNI ILPMLFILFI SWTAFWSTSY EANVTLVVST LIAHIAFNIL VETNLPKTPY MTYTGAIIFM IYLFYFVAVI EVTVQHYLKV ESQPARAASI TRASRIAFPV VFLLANIILA FLFFGF. It is sometimes possible for the material contained within the vial of "Proton-gated ion channel (glvI), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
