Glutamate receptor 1.1 (GLR1.1) Recombinant Protein | GLR1.1 recombinant protein
Recombinant Arabidopsis thaliana Glutamate receptor 1.1 (GLR1.1)
Gene Names
GLR1.1; ATGLR1.1; GLR1; GLR1.1; GLUTAMATE RECEPTOR 1; glutamate receptor 1.1; T6K12.27; T6K12_27
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glutamate receptor 1.1 (GLR1.1); Recombinant Arabidopsis thaliana Glutamate receptor 1.1 (GLR1.1); GLR1.1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
20-808aa; full length protein
Sequence
APSDDDVFEEVRVGLVVDLSSIQGKILETSFNLALSDFYGINNGYRTRVSVLVRDSQGDP IIALAAATDLLKNAKAEAIVGAQSLQEAKLLATISEKAKVPVISTFLPNTLSLKKYDNFI QWTHDTTSEAKGITSLIQDFSCKSVVVIYEDADDWSESLQILVENFQDKGIYIARSASFA VSSSGENHMMNQLRKLKVSRASVFVVHMSEILVSRLFQCVEKLGLMEEAFAWILTARTMN YLEHFAITRSMQGVIGFKSYIPVSEEVKNFTSRLRKRMGDDTETEHSSVIIGLRAHDIAC ILANAVEKFSVSGKVEASSNVSADLLDTIRHSRFKGLSGDIQISDNKFISETFEIVNIGR EKQRRIGLWSGGSFSQRRQIVWPGRSRKIPRHRVLAEKGEKKVLRVLVTAGNKVPHLVSV RPDPETGVNTVSGFCVEVFKTCIAPFNYELEFIPYRGNNDNLAYLLSTQRDKYDAAVGDI TITSNRSLYVDFTLPYTDIGIGILTVKKKSQGMWTFFDPFEKSLWLASGAFFVLTGIVVW LVERSVNPEFQGSWGQQLSMMLWFGFSTIVFAHREKLQKMSSRFLVIVWVFVVLILTSSY SANLTSTKTISRMQLNHQMVFGGSTTSMTAKLGSINAVEAYAQLLRDGTLNHVINEIPYL SILIGNYPNDFVMTDRVTNTNGFGFMFQKGSDLVPKVSREIAKLRSLGMLKDMEKKWFQK LDSLNVHSNTEEVASTNDDDEASKRFTFRELRGLFIIAGAAHVLVLALHLFHTRQEVSRL CTKLQSFYK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for GLR1.1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
90,509 Da
NCBI Official Full Name
glutamate receptor 1.1
NCBI Official Symbol
GLR1.1
NCBI Official Synonym Symbols
ATGLR1.1; GLR1; GLR1.1; GLUTAMATE RECEPTOR 1; glutamate receptor 1.1; T6K12.27; T6K12_27
NCBI Protein Information
glutamate receptor 1.1
UniProt Protein Name
Glutamate receptor 1.1
Protein Family
UniProt Gene Name
GLR1.1
UniProt Synonym Gene Names
GLR1; AtGLR1
UniProt Entry Name
GLR11_ARATH
NCBI Description
putative glutamate receptor (GLR1.1). Contains a functional cation - permeable pore domain. Involved in cellular cation homeostasis.
Uniprot Description
Glutamate-gated receptor that probably acts as non-selective cation channel. Can transport sodium, potassium, and calcium ions. Functions as a carbon and nitrogen regulator and/or sensor that regulates carbon and nitrogen metabolism and distinct physiological process such as germination through the control of acid abscisic (ABA) biosynthesis. May be involved in light-signal transduction and calcium homeostasis via the regulation of calcium influx into cells. Seems required for the regulation of the abscisic acid (ABA) signaling pathway that modulates many aspects of plant physiology such as seed germination and response to drought (e.g. stomata opening).
Research Articles on GLR1.1
Similar Products
Product Notes
The GLR1.1 glr1.1 (Catalog #AAA7015883) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-808aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the GLR1.1 glr1.1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: APSDDDVFEE VRVGLVVDLS SIQGKILETS FNLALSDFYG INNGYRTRVS VLVRDSQGDP IIALAAATDL LKNAKAEAIV GAQSLQEAKL LATISEKAKV PVISTFLPNT LSLKKYDNFI QWTHDTTSEA KGITSLIQDF SCKSVVVIYE DADDWSESLQ ILVENFQDKG IYIARSASFA VSSSGENHMM NQLRKLKVSR ASVFVVHMSE ILVSRLFQCV EKLGLMEEAF AWILTARTMN YLEHFAITRS MQGVIGFKSY IPVSEEVKNF TSRLRKRMGD DTETEHSSVI IGLRAHDIAC ILANAVEKFS VSGKVEASSN VSADLLDTIR HSRFKGLSGD IQISDNKFIS ETFEIVNIGR EKQRRIGLWS GGSFSQRRQI VWPGRSRKIP RHRVLAEKGE KKVLRVLVTA GNKVPHLVSV RPDPETGVNT VSGFCVEVFK TCIAPFNYEL EFIPYRGNND NLAYLLSTQR DKYDAAVGDI TITSNRSLYV DFTLPYTDIG IGILTVKKKS QGMWTFFDPF EKSLWLASGA FFVLTGIVVW LVERSVNPEF QGSWGQQLSM MLWFGFSTIV FAHREKLQKM SSRFLVIVWV FVVLILTSSY SANLTSTKTI SRMQLNHQMV FGGSTTSMTA KLGSINAVEA YAQLLRDGTL NHVINEIPYL SILIGNYPND FVMTDRVTNT NGFGFMFQKG SDLVPKVSRE IAKLRSLGML KDMEKKWFQK LDSLNVHSNT EEVASTNDDD EASKRFTFRE LRGLFIIAGA AHVLVLALHL FHTRQEVSRL CTKLQSFYK. It is sometimes possible for the material contained within the vial of "Glutamate receptor 1.1 (GLR1.1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
