Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Glycoprotein K (gK) Recombinant Protein | UL53 recombinant protein

Recombinant Human herpesvirus 1 Glycoprotein K (gK)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glycoprotein K (gK); Recombinant Human herpesvirus 1 Glycoprotein K (gK); Recombinant Glycoprotein K (gK); Glycoprotein K; gK; Syncytial protein; UL53 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
31-338
Sequence
ASPLHRCIYAVRPTGTNNDTALVWMKMNQTLLFLGAPTHPPNGGWRNHAHICYANLIAGRVVPFQVPPDAMNRRIMNVHEAVNCLETLWYTRVRLVVVGWFLYLAFVALHQRRCMFGVVSPAHKMVAPATYLLNYAGRIVSSVFLQYPYTKITRLLCELSVQRQNLVQLFETDPVTFLYHRPAIGVIVGCELMLRFVAVGLIVGTAFISRGACAITYPLFLTITTWCFVSTIGLTELYCILRRGPAPKNADKAAAPGRSKGLSGVCGRCCSIILSGIAVRLCYIAVVAGVVLVALHYEQEIQRRLFDV
Sequence Length
338
Species
Human herpesvirus 1 (strain MP) (HHV-1) (Human herpes simplex virus 1)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,573 Da
NCBI Official Full Name
envelope glycoprotein K
NCBI Official Symbol
UL53
NCBI Protein Information
type 3 membrane protein; contains a signal peptide; 4 transmembrane domains; envelope glycoprotein K
UniProt Protein Name
Glycoprotein K
UniProt Gene Name
gK
UniProt Synonym Gene Names
gK
UniProt Entry Name
GK_HHV11

Uniprot Description

Function: Glycoprotein that probably modulates membrane fusion events during secondary envelopment of cytoplasmic capsids that bud into specific trans-Golgi network (TGN)-derived membranes. Also plays a role, together with gB, in virus-induced cell-to-cell fusion (syncytia formation). Seems to block fusion of virions with infected-cell membranes. Ref.10 Ref.12

Subunit structure: Interacts (via UL20 interaction region) with protein UL20 (via N-terminus); this interaction probably plays a role in the coordinate transport of protein UL20 and gK to the trans-Golgi network (TGN), and is required for the cell surface expression of gK. Ref.13

Subcellular location: Host cell membrane; Multi-pass membrane protein. Host endosome membrane; Multi-pass membrane protein

By similarity. Host Golgi apparatus membrane; Multi-pass membrane protein. Note: During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported with UL20 to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN). Cell surface expression of gK is required for virus-induced cell-to-cell fusion. Likely not present in extracellular virions. Ref.8 Ref.9 Ref.11 Ref.14

Post-translational modification: N-glycosylated.

Sequence similarities: Belongs to the alphaherpesvirinae glycoprotein K family.

Research Articles on UL53

Similar Products

Product Notes

The UL53 gk (Catalog #AAA1104651) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 31-338. The amino acid sequence is listed below: ASPLHRCIYA VRPTGTNNDT ALVWMKMNQT LLFLGAPTHP PNGGWRNHAH ICYANLIAGR VVPFQVPPDA MNRRIMNVHE AVNCLETLWY TRVRLVVVGW FLYLAFVALH QRRCMFGVVS PAHKMVAPAT YLLNYAGRIV SSVFLQYPYT KITRLLCELS VQRQNLVQLF ETDPVTFLYH RPAIGVIVGC ELMLRFVAVG LIVGTAFISR GACAITYPLF LTITTWCFVS TIGLTELYCI LRRGPAPKNA DKAAAPGRSK GLSGVCGRCC SIILSGIAVR LCYIAVVAGV VLVALHYEQE IQRRLFDV. It is sometimes possible for the material contained within the vial of "Glycoprotein K (gK), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.