Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Gap junction alpha-8 protein (GJA8) Recombinant Protein | GJA8 recombinant protein

Recombinant Human Gap junction alpha-8 protein (GJA8)

Gene Names
GJA8; CAE; CAE1; CX50; CZP1; MP70; CTRCT1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Gap junction alpha-8 protein (GJA8); Recombinant Human Gap junction alpha-8 protein (GJA8); GJA8 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-433aa; Full length protein
Sequence
GDWSFLGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQSDFVCNTQQPGC ENVCYDEAFPISHIRLWVLQIIFVSTPSLMYVGHAVHYVRMEEKRKSREAEELGQQAGTN GGPDQGSVKKSSGSKGTKKFRLEGTLLRTYICHIIFKTLFEVGFIVGHYFLYGFRILPLY RCSRWPCPNVVDCFVSRPTEKTIFILFMLSVASVSLFLNVMELGHLGLKGIRSALKRPVE QPLGEIPEKSLHSIAVSSIQKAKGYQLLEEEKIVSHYFPLTEVGMVETSPLPAKPFNQFE EKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKKEEAERLTTEEQ EKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLPAEKTPSLCPELTTDDARPLSRLSK ASSRARSDDLTV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for GJA8 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,229 Da
NCBI Official Full Name
gap junction alpha-8 protein
NCBI Official Synonym Full Names
gap junction protein alpha 8
NCBI Official Symbol
GJA8
NCBI Official Synonym Symbols
CAE; CAE1; CX50; CZP1; MP70; CTRCT1
NCBI Protein Information
gap junction alpha-8 protein
UniProt Protein Name
Gap junction alpha-8 protein
UniProt Gene Name
GJA8
UniProt Synonym Gene Names
Cx50
UniProt Entry Name
CXA8_HUMAN

NCBI Description

This gene encodes a transmembrane connexin protein that is necessary for lens growth and maturation of lens fiber cells. The encoded protein is a component of gap junction channels and functions in a calcium and pH-dependent manner. Mutations in this gene have been associated with zonular pulverulent cataracts, nuclear progressive cataracts, and cataract-microcornea syndrome. [provided by RefSeq, Dec 2009]

Uniprot Description

GJA8: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. A connexon is composed of a hexamer of connexins. This particular connexin only forms junctional channels. Eye lens. Belongs to the connexin family. Alpha-type (group II) subfamily.

Protein type: Membrane protein, multi-pass; Channel, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q21.1

Cellular Component: connexon complex; integral to plasma membrane

Molecular Function: channel activity; gap junction channel activity

Biological Process: cell-cell signaling; lens development in camera-type eye; protein homooligomerization; transmembrane transport; transport; visual perception

Disease: Cataract 1, Multiple Types; Chromosome 1q21.1 Deletion Syndrome, 1.35-mb

Research Articles on GJA8

Similar Products

Product Notes

The GJA8 gja8 (Catalog #AAA7015700) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-433aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the GJA8 gja8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GDWSFLGNIL EEVNEHSTVI GRVWLTVLFI FRILILGTAA EFVWGDEQSD FVCNTQQPGC ENVCYDEAFP ISHIRLWVLQ IIFVSTPSLM YVGHAVHYVR MEEKRKSREA EELGQQAGTN GGPDQGSVKK SSGSKGTKKF RLEGTLLRTY ICHIIFKTLF EVGFIVGHYF LYGFRILPLY RCSRWPCPNV VDCFVSRPTE KTIFILFMLS VASVSLFLNV MELGHLGLKG IRSALKRPVE QPLGEIPEKS LHSIAVSSIQ KAKGYQLLEE EKIVSHYFPL TEVGMVETSP LPAKPFNQFE EKISTGPLGD LSRGYQETLP SYAQVGAQEV EGEGPPAEEG AEPEVGEKKE EAERLTTEEQ EKVAVPEGEK VETPGVDKEG EKEEPQSEKV SKQGLPAEKT PSLCPELTTD DARPLSRLSK ASSRARSDDL TV. It is sometimes possible for the material contained within the vial of "Gap junction alpha-8 protein (GJA8), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.