Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (82.43kD).)

Mouse anti-Human BAIAP2 Monoclonal Antibody | anti-BAIAP2 antibody

BAIAP2 (Brain-specific Angiogenesis Inhibitor 1-associated Protein 2, BAI1-associated Protein 2, BAI-associated Protein 2, Protein BAP2, Insulin Receptor Substrate Protein of 53kD, Insulin Receptor Substrate p53, IRSp53, Insulin Receptor Substrate p53/p58

Gene Names
BAIAP2; BAP2; FLAF3; IRSP53
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BAIAP2; Monoclonal Antibody; BAIAP2 (Brain-specific Angiogenesis Inhibitor 1-associated Protein 2; BAI1-associated Protein 2; BAI-associated Protein 2; Protein BAP2; Insulin Receptor Substrate Protein of 53kD; Insulin Receptor Substrate p53; IRSp53; Insulin Receptor Substrate p53/p58; anti-BAIAP2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3F3-2D3
Specificity
Recognizes human BAIAP2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-BAIAP2 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-512 from BAIAP2 (AAH32559) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMNGVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQGLDDYGARSMSR
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (82.43kD).)

Western Blot (WB) (Western Blot detection against Immunogen (82.43kD).)

Western Blot (WB)

(Western Blot analysis of BAIAP2 expression in transfected 293T cell line by BAIAP2 monoclonal antibody Lane 1: BAIAP2 transfected lysate (57kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BAIAP2 expression in transfected 293T cell line by BAIAP2 monoclonal antibody Lane 1: BAIAP2 transfected lysate (57kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of BAIAP2 transfected lysate using BAIAP2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with BAIAP2 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of BAIAP2 transfected lysate using BAIAP2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with BAIAP2 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged BAIAP2 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged BAIAP2 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-BAIAP2 antibody
BAIAP2, a target of p53, has been identified as a brain-specific angiogenesis inhibitor (BAI1)-binding protein. This interaction at the cytoplasmic membrane is crucial to the function of this protein, which may be involved in neuronal growth-cone guidance. This protein functions as an insulin receptor tyrosine kinase substrate and suggests a role for insulin in the central nervous system. This protein has also been identified as interacting with the dentatorubral-pallidoluysian atrophy gene, which is associated with an autosomal dominant neurodegenerative disease. It also associates with a downstream effector of Rho small G proteins, which is associated with the formation of stress fibers and cytokinesis.
Product Categories/Family for anti-BAIAP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
57,430 Da
NCBI Official Full Name
Homo sapiens BAI1-associated protein 2, mRNA
NCBI Official Synonym Full Names
BAI1 associated protein 2
NCBI Official Symbol
BAIAP2
NCBI Official Synonym Symbols
BAP2; FLAF3; IRSP53
NCBI Protein Information
brain-specific angiogenesis inhibitor 1-associated protein 2

NCBI Description

The protein encoded by this gene has been identified as a brain-specific angiogenesis inhibitor (BAI1)-binding protein. This adaptor protein links membrane bound G-proteins to cytoplasmic effector proteins. This protein functions as an insulin receptor tyrosine kinase substrate and suggests a role for insulin in the central nervous system. It also associates with a downstream effector of Rho small G proteins, which is associated with the formation of stress fibers and cytokinesis. This protein is involved in lamellipodia and filopodia formation in motile cells and may affect neuronal growth-cone guidance. This protein has also been identified as interacting with the dentatorubral-pallidoluysian atrophy gene, which is associated with an autosomal dominant neurodegenerative disease. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Jan 2009]

Research Articles on BAIAP2

Similar Products

Product Notes

The BAIAP2 (Catalog #AAA6156693) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BAIAP2 (Brain-specific Angiogenesis Inhibitor 1-associated Protein 2, BAI1-associated Protein 2, BAI-associated Protein 2, Protein BAP2, Insulin Receptor Substrate Protein of 53kD, Insulin Receptor Substrate p53, IRSp53, Insulin Receptor Substrate p53/p58 reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BAIAP2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BAIAP2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BAIAP2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.