PERQ amino acid-rich with GYF domain-containing protein 2 (GIGYF2) Recombinant Protein | GIGYF2 recombinant protein

Recombinant Human PERQ amino acid-rich with GYF domain-containing protein 2 (GIGYF2) , partial

Cat. Num. AAA1289595

• Gene Names: GIGYF2; GYF2; PERQ2; PERQ3; PARK11; TNRC15
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: PERQ amino acid-rich with GYF domain-containing protein 2 (GIGYF2); Recombinant Human PERQ amino acid-rich with GYF domain-containing protein 2 (GIGYF2); partial; GIGYF2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 510-1030
• Sequence: ERLASKLQEHRAKGVSIPLMHEAMQKWYYKDPQGEIQGPFNNQEMAEWFQAGYFTMSLLVKRACDESFQPLGDIMKMWGRVPFSPGPAPPPHMGELDQERLTRQQELTALYQMQHLQYQQFLIQQQYAQVLAQQQKAALSSQQQQQLALLLQQFQTLKMRISDQNIIPSVTRSVSVPDTGSIWELQPTASQPTVWEGGSVWDLPLDTTTPGPALEQLQQLEKAKAAKLEQERREAEMRAKREEEERKRQEELRRQ
• Sequence Length: 1299

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

Related Product Information for GIGYF2 recombinant protein

This protein interacts with GRB10 and may be involved in the regulation of tyrosine kinase receptor signaling. This gene contains CAG repeats, and the encoded protein contains stretches glutamine and glutamic acid residues. Defects in this gene are a cause of Parkinson disease type 11 (PARK11). Multiple transcript variants encoding several different isoforms have been found for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 156766043
• NCBI GeneID: 26058
• NCBI Accession #: NP_001096616.1
• NCBI GenBank Nucleotide #: NM_001103146.1
• UniProt Accession #: Q6Y7W6; O75137; Q7Z2Z8; Q7Z3I2; Q96HU4; Q9NV82; A6H8W4; B9EG55; E9PBB0
• Molecular Weight: 64.6 kDa
• NCBI Official Full Name: GRB10-interacting GYF protein 2 isoform b
• NCBI Official Synonym Full Names: GRB10 interacting GYF protein 2
• NCBI Official Symbol: GIGYF2
• NCBI Official Synonym Symbols: GYF2; PERQ2; PERQ3; PARK11; TNRC15
• NCBI Protein Information: GRB10-interacting GYF protein 2
• UniProt Protein Name: GRB10-interacting GYF protein 2
• Protein Family: PERQ amino acid-rich with GYF domain-containing protein
• UniProt Gene Name: GIGYF2

NCBI Description

This gene contains CAG trinucleotide repeats and encodes a protein containing several stretches of polyglutamine residues. The encoded protein may be involved in the regulation of tyrosine kinase receptor signaling. This gene is located in a chromosomal region that was genetically linked to Parkinson disease type 11, and mutations in this gene were thought to be causative for this disease. However, more recent studies in different populations have been unable to replicate this association. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]

Uniprot Description

Key component of the 4EHP-GYF2 complex, a multiprotein complex that acts as a repressor of translation initiation (PubMed:22751931). In 4EHP-GYF2 the complex, acts as a factor that bridges EIF4E2 to ZFP36/TTP, linking translation repression with mRNA decay (). May act cooperatively with GRB10 to regulate tyrosine kinase receptor signaling, including IGF1 and insulin receptors (PubMed:12771153).