Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PERQ2Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human GIGYF2 Polyclonal Antibody | anti-GIGYF2 antibody

GIGYF2 Antibody - N-terminal region

Gene Names
GIGYF2; GYF2; PERQ2; PERQ3; PARK11; TNRC15
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GIGYF2; Polyclonal Antibody; GIGYF2 Antibody - N-terminal region; anti-GIGYF2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LAGSRRDGERWRPHSPDGPRSAGWREHMERRRRFEFDFRDRDDERGYRRV
Sequence Length
1299
Applicable Applications for anti-GIGYF2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PERQ2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PERQ2Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PERQ2Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GIGYF2 antibody
This is a rabbit polyclonal antibody against PERQ2. It was validated on Western Blot

Target Description: This gene contains CAG trinucleotide repeats and encodes a protein containing several stretches of polyglutamine residues. The encoded protein may be involved in the regulation of tyrosine kinase receptor signaling. This gene is located in a chromosomal region that was genetically linked to Parkinson disease type 11, and mutations in this gene were thought to be causative for this disease. However, more recent studies in different populations have been unable to replicate this association. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-GIGYF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
142kDa
NCBI Official Full Name
GRB10-interacting GYF protein 2 isoform b
NCBI Official Synonym Full Names
GRB10 interacting GYF protein 2
NCBI Official Symbol
GIGYF2
NCBI Official Synonym Symbols
GYF2; PERQ2; PERQ3; PARK11; TNRC15
NCBI Protein Information
GRB10-interacting GYF protein 2
UniProt Protein Name
PERQ amino acid-rich with GYF domain-containing protein 2
UniProt Gene Name
GIGYF2
UniProt Synonym Gene Names
KIAA0642; PERQ2; TNRC15
UniProt Entry Name
PERQ2_HUMAN

NCBI Description

This gene contains CAG trinucleotide repeats and encodes a protein containing several stretches of polyglutamine residues. The encoded protein may be involved in the regulation of tyrosine kinase receptor signaling. This gene is located in a chromosomal region that was genetically linked to Parkinson disease type 11, and mutations in this gene were thought to be causative for this disease. However, more recent studies in different populations have been unable to replicate this association. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]

Research Articles on GIGYF2

Similar Products

Product Notes

The GIGYF2 gigyf2 (Catalog #AAA3219489) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GIGYF2 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GIGYF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GIGYF2 gigyf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LAGSRRDGER WRPHSPDGPR SAGWREHMER RRRFEFDFRD RDDERGYRRV. It is sometimes possible for the material contained within the vial of "GIGYF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.