Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Figure. SDS-PAGE)

Green Fluorescent Protein Recombinant Protein | GFP recombinant protein

Recombinant Green Fluorescent Protein (GFP)

Applications
SDS-Page, Western Blot
Purity
>90%
Synonyms
Green Fluorescent Protein; Recombinant Green Fluorescent Protein (GFP); GFP recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>90%
Form/Format
Freeze-dried powder
20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
Sequence Positions
KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag
Sequence Length
238
Applicable Applications for GFP recombinant protein
Positive Control, Immunogen, SDS-PAGE, Western Blot (WB)
Source
Prokaryotic expression
Species
General
Tag
N-terminal His Tag
Isoelectric Point
5.6
Reconstitution
Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Preparation and Storage
Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months. Avoid repeated freeze/thaw cycles.
Stability: The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

SDS-Page

(Figure. SDS-PAGE)

SDS-Page (Figure. SDS-PAGE)

Gene Sequencing

(Figure. Gene Sequencing (Extract))

Gene Sequencing (Figure. Gene Sequencing (Extract))

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
Predicted Molecular Mass: 37.0kDa
Accurate Molecular Mass: 39kDa
NCBI Official Full Name
Green fluorescent protein
UniProt Protein Name
Green fluorescent protein
Protein Family
UniProt Gene Name
GFP
UniProt Entry Name
GFP_AEQVI

Uniprot Description

Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca2+-activated photoprotein aequorin.

Similar Products

Product Notes

The GFP gfp (Catalog #AAA2123050) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AAA Biotech's Green Fluorescent Protein can be used in a range of immunoassay formats including, but not limited to, Positive Control, Immunogen, SDS-PAGE, Western Blot (WB). Researchers should empirically determine the suitability of the GFP gfp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Green Fluorescent Protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.