Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Glial cell line-derived neurotrophic factor Recombinant Protein | GDNF recombinant protein

Recombinant Human Glial cell line-derived neurotrophic factor

Gene Names
GDNF; ATF1; ATF2; HSCR3; HFB1-GDNF
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glial cell line-derived neurotrophic factor; Recombinant Human Glial cell line-derived neurotrophic factor; Astrocyte-derived trophic factor; ATF; GDNF recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
78-211aa; Full Length
Sequence
SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Sequence Length
211
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for GDNF recombinant protein
Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake.
Product Categories/Family for GDNF recombinant protein
References
GDNF a glial cell line-derived neurotrophic factor for midbrain dopaminergic neurons.Lin L.-F.H., Doherty D.H., Lile J.D., Bektesh S., Collins F.Science 260:1130-1132(1993)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
15.1 kDa
NCBI Official Full Name
glial cell line-derived neurotrophic factor isoform 1 preproprotein
NCBI Official Synonym Full Names
glial cell derived neurotrophic factor
NCBI Official Symbol
GDNF
NCBI Official Synonym Symbols
ATF1; ATF2; HSCR3; HFB1-GDNF
NCBI Protein Information
glial cell line-derived neurotrophic factor
UniProt Protein Name
Glial cell line-derived neurotrophic factor
UniProt Gene Name
GDNF
UniProt Synonym Gene Names
hGDNF; ATF
UniProt Entry Name
GDNF_HUMAN

NCBI Description

This gene encodes a highly conserved neurotrophic factor. The recombinant form of this protein was shown to promote the survival and differentiation of dopaminergic neurons in culture, and was able to prevent apoptosis of motor neurons induced by axotomy. The encoded protein is processed to a mature secreted form that exists as a homodimer. The mature form of the protein is a ligand for the product of the RET (rearranged during transfection) protooncogene. Multiple transcript variants encoding different isoforms have been found for this gene. Mutations in this gene may be associated with Hirschsprung disease. [provided by RefSeq, Jun 2010]

Uniprot Description

GDNF: Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake. Defects in GDNF may be a cause of Hirschsprung disease type 3 (HSCR3). In association with mutations of RET gene, defects in GDNF may be involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. Defects in GDNF are a cause of congenital central hypoventilation syndrome (CCHS); also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. Belongs to the TGF-beta family. GDNF subfamily. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 5p13.1-p12

Cellular Component: extracellular region

Molecular Function: growth factor activity; protein binding; protein homodimerization activity; receptor binding

Biological Process: adult locomotory behavior; axon guidance; enteric nervous system development; induction of an organ; metanephros development; mRNA stabilization; negative regulation of apoptosis; negative regulation of neuron apoptosis; nervous system development; neural crest cell migration; neurite development; peristalsis; positive regulation of cell differentiation; positive regulation of cell proliferation; positive regulation of dopamine secretion; positive regulation of monooxygenase activity; positive regulation of transcription from RNA polymerase II promoter; postganglionic parasympathetic nervous system development; postsynaptic membrane organization; regulation of dopamine uptake; regulation of gene expression; signal transduction; sympathetic nervous system development; ureteric bud branching

Disease: Central Hypoventilation Syndrome, Congenital; Hirschsprung Disease, Susceptibility To, 3; Pheochromocytoma

Research Articles on GDNF

Similar Products

Product Notes

The GDNF gdnf (Catalog #AAA1265238) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 78-211aa; Full Length. The amino acid sequence is listed below: SPDKQMAVLP RRERNRQAAA ANPENSRGKG RRGQRGKNRG CVLTAIHLNV TDLGLGYETK EELIFRYCSG SCDAAETTYD KILKNLSRNR RLVSDKVGQA CCRPIAFDDD LSFLDDNLVY HILRKHSAKR CGCI. It is sometimes possible for the material contained within the vial of "Glial cell line-derived neurotrophic factor, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.