Glial cell line-derived neurotrophic factor (Gdnf) Recombinant Protein | Gdnf recombinant protein

Recombinant Mouse Glial cell line-derived neurotrophic factor (Gdnf)

Cat. Num. AAA965352

• Gene Names: Gdnf; ATF; AI385739
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Glial cell line-derived neurotrophic factor (Gdnf); Recombinant Mouse Glial cell line-derived neurotrophic factor (Gdnf); Gdnf recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 78-211, Full length protein
• Sequence: SPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI
• Sequence Length: 134

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Gdnf recombinant protein

This gene encodes a highly conserved neurotrophic factor. The recombinant form of this protein was shown to promote the survival and differentiation of dopaminergic neurons in culture, and was able to prevent apoptosis of motor neurons induced by axotomy. The encoded protein is processed to a mature secreted form that exists as a homodimer. The mature form of the protein is a ligand for the product of the RET (rearranged during transfection) protooncogene. In addition to the transcript encoding GDNF, two additional alternative transcripts encoding distinct proteins, referred to as astrocyte-derived trophic factors, have also been described. Mutations in this gene may be associated with Hirschsprung disease.

NCBI and Uniprot Product Information

• NCBI GI #: 672349281
• NCBI GeneID: 14573
• NCBI Accession #: NP_001288261.1
• NCBI GenBank Nucleotide #: NM_001301332.1
• UniProt Accession #: P48540; O09058; P70446; P97919; P97920; Q6LEL9
• Molecular Weight: 26,606 Da
• NCBI Official Full Name: glial cell line-derived neurotrophic factor isoform 2
• NCBI Official Synonym Full Names: glial cell line derived neurotrophic factor
• NCBI Official Symbol: Gdnf
• NCBI Official Synonym Symbols: ATF; AI385739
• NCBI Protein Information: glial cell line-derived neurotrophic factor
• UniProt Protein Name: Glial cell line-derived neurotrophic factor
• Protein Family: Glial cell line-derived neurotrophic factor
• UniProt Gene Name: Gdnf
• UniProt Synonym Gene Names: mGDNF; ATF

NCBI Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The recombinant form of this protein, a highly conserved neurotrophic factor, was shown to promote the survival and differentiation of dopaminergic neurons in culture, and was able to prevent apoptosis of motor neurons induced by axotomy. This protein is a ligand for the product of the RET (rearranged during transfection) protooncogene. Homozygous knockout mice for this gene exhibit defects in kidney development and neonatal death. This gene encodes multiple protein isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Aug 2016]

Uniprot Description

Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake.