Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Bone morphogenetic protein 3B (Gdf10) Recombinant Protein | Gdf10 recombinant protein

Recombinant Rat Bone morphogenetic protein 3B (Gdf10)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Bone morphogenetic protein 3B (Gdf10); Recombinant Rat Bone morphogenetic protein 3B (Gdf10); Gdf10 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
367-476, Full length protein
Sequence
QWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIVPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVETCACR
Sequence Length
110
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Gdf10 recombinant protein
This protein is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in mice suggest that This protein plays a role in skeletal morphogenesis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,961 Da
NCBI Official Full Name
growth/differentiation factor 10
NCBI Official Synonym Full Names
growth differentiation factor 10
NCBI Official Symbol
Gdf10
NCBI Protein Information
growth/differentiation factor 10
UniProt Protein Name
Growth/differentiation factor 10
UniProt Gene Name
Gdf10
UniProt Synonym Gene Names
GDF-10; BMP-3B; BIP

NCBI Description

may play a role in the central nervous system, in bone formation and remodeling [RGD, Feb 2006]

Uniprot Description

Growth factor involved in osteogenesis and adipogenesis. Plays an inhibitory role in the process of osteoblast differentiation via SMAD2/3 pathway. Plays an inhibitory role in the process of adipogenesis.

Research Articles on Gdf10

Similar Products

Product Notes

The Gdf10 gdf10 (Catalog #AAA962675) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 367-476, Full length protein. The amino acid sequence is listed below: QWDEPRVCSR RYLKVDFADI GWNEWIISPK SFDAYYCAGA CEFPMPKIVR PSNHATIQSI VRAVGIVPGI PEPCCVPDKM NSLGVLFLDE NRNVVLKVYP NMSVETCACR. It is sometimes possible for the material contained within the vial of "Bone morphogenetic protein 3B (Gdf10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.