Germinal center B-cell-expressed transcript 2 protein (Gcet2) Recombinant Protein | Gcet2 recombinant protein
Recombinant Mouse Germinal center B-cell-expressed transcript 2 protein (Gcet2)
Gene Names
Gcsam; M17; Gcet; Gcet2; M17-L
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Germinal center B-cell-expressed transcript 2 protein (Gcet2); Recombinant Mouse Germinal center B-cell-expressed transcript 2 protein (Gcet2); Gcet2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-181, full length protein
Sequence
MGNCLQRTTRWQLDMQETPWNLRLSAKGRTCRYFRGWSCCHSVEGCSCLPWKNIRTFKARQESPKQNEGMTSAPVQDNANETYTEELCYILVDHEAVRGRPSVNPAEGFYENISNKAERHKESSRGTETEYSVLRFPSPPQPLPSTDDEYELLMPSRFSSHAFQQPRPLTTPYETHFSYPQ
Sequence Length
181
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Gcet2 recombinant protein
This gene encodes a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4. Alternative splicing results in multiple transcript variants encoding different isoforms.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
18,316 Da
NCBI Official Full Name
germinal center-associated signaling and motility protein isoform 1
NCBI Official Synonym Full Names
germinal center associated, signaling and motility
NCBI Official Symbol
Gcsam
NCBI Official Synonym Symbols
M17; Gcet; Gcet2; M17-L
NCBI Protein Information
germinal center-associated signaling and motility protein
UniProt Protein Name
Germinal center-associated signaling and motility protein
UniProt Gene Name
Gcsam
UniProt Synonym Gene Names
Gcet; Gcet2; M17
Uniprot Description
Involved in the negative regulation of lymphocyte motility. It mediates the migration-inhibitory effects of IL6. Serves as a positive regulator of the RhoA signaling pathway. Enhancement of RhoA activation results in inhibition of lymphocyte and lymphoma cell motility by activation of its downstream effector ROCK. Is a regulator of B-cell receptor signaling, that acts through SYK kinase activation.
Research Articles on Gcet2
Similar Products
Product Notes
The Gcet2 gcsam (Catalog #AAA1387739) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-181, full length protein. The amino acid sequence is listed below: MGNCLQRTTR WQLDMQETPW NLRLSAKGRT CRYFRGWSCC HSVEGCSCLP WKNIRTFKAR QESPKQNEGM TSAPVQDNAN ETYTEELCYI LVDHEAVRGR PSVNPAEGFY ENISNKAERH KESSRGTETE YSVLRFPSPP QPLPSTDDEY ELLMPSRFSS HAFQQPRPLT TPYETHFSYP Q. It is sometimes possible for the material contained within the vial of "Germinal center B-cell-expressed transcript 2 protein (Gcet2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
