GATA zinc finger domain-containing protein 1 (GATAD1) Recombinant Protein | GATAD1 recombinant protein
Recombinant Human GATA zinc finger domain-containing protein 1 (GATAD1)
Gene Names
GATAD1; ODAG; CMD2B; RG083M05.2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
GATA zinc finger domain-containing protein 1 (GATAD1); Recombinant Human GATA zinc finger domain-containing protein 1 (GATAD1); GATAD1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-269, Full length protein
Sequence
MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGRGGAGSGGAGSGAAGGTGGSGGGGFGAATFASTSATPPQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRRHIFKLKNPIKAPESVSTIITAESIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIPTLSSPRDQFDPASYIIGPEEDLPRKMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKESVANHL
Sequence Length
269
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28,690 Da
NCBI Official Full Name
GATA zinc finger domain-containing protein 1
NCBI Official Synonym Full Names
GATA zinc finger domain containing 1
NCBI Official Symbol
GATAD1
NCBI Official Synonym Symbols
ODAG; CMD2B; RG083M05.2
NCBI Protein Information
GATA zinc finger domain-containing protein 1
UniProt Protein Name
GATA zinc finger domain-containing protein 1
Protein Family
UniProt Gene Name
GATAD1
UniProt Synonym Gene Names
ODAG
NCBI Description
The protein encoded by this gene contains a zinc finger at the N-terminus, and is thought to bind to a histone modification site that regulates gene expression. Mutations in this gene have been associated with autosomal recessive dilated cardiomyopathy. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jun 2012]
Uniprot Description
Component of some chromatin complex recruited to chromatin sites methylated 'Lys-4' of histone H3 (H3K4me).
Research Articles on GATAD1
Similar Products
Product Notes
The GATAD1 gatad1 (Catalog #AAA1374855) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-269, Full length protein. The amino acid sequence is listed below: MPLGLKPTCS VCKTTSSSMW KKGAQGEILC HHCTGRGGAG SGGAGSGAAG GTGGSGGGGF GAATFASTSA TPPQSNGGGG GKQSKQEIHR RSARLRNTKY KSAPAAEKKV STKGKGRRHI FKLKNPIKAP ESVSTIITAE SIFYKGVYYQ IGDVVSVIDE QDGKPYYAQI RGFIQDQYCE KSAALTWLIP TLSSPRDQFD PASYIIGPEE DLPRKMEYLE FVCHAPSEYF KSRSSPFPTV PTRPEKGYIW THVGPTPAIT IKESVANHL. It is sometimes possible for the material contained within the vial of "GATA zinc finger domain-containing protein 1 (GATAD1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
