Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GATAD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: K562 cell lysateGATAD1 is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells)

Rabbit GATAD1 Polyclonal Antibody | anti-GATAD1 antibody

GATAD1 antibody - C-terminal region

Gene Names
GATAD1; ODAG; CMD2B; RG083M05.2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GATAD1; Polyclonal Antibody; GATAD1 antibody - C-terminal region; anti-GATAD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKES
Sequence Length
269
Applicable Applications for anti-GATAD1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GATAD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GATAD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: K562 cell lysateGATAD1 is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells)

Western Blot (WB) (WB Suggested Anti-GATAD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: K562 cell lysateGATAD1 is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells)
Related Product Information for anti-GATAD1 antibody
This is a rabbit polyclonal antibody against GATAD1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ODAG (Ocular development-associated gene), a novel transcription factor located on chromosome 7, encodes a protein that may play a role in eye development. mRNA profiling in multiple human tissue indicates that ODAG is expressed in human CD56+ NK cells and thyroid tissue.
Product Categories/Family for anti-GATAD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
GATA zinc finger domain-containing protein 1
NCBI Official Synonym Full Names
GATA zinc finger domain containing 1
NCBI Official Symbol
GATAD1
NCBI Official Synonym Symbols
ODAG; CMD2B; RG083M05.2
NCBI Protein Information
GATA zinc finger domain-containing protein 1
UniProt Protein Name
GATA zinc finger domain-containing protein 1
UniProt Gene Name
GATAD1
UniProt Synonym Gene Names
ODAG
UniProt Entry Name
GATD1_HUMAN

NCBI Description

The protein encoded by this gene contains a zinc finger at the N-terminus, and is thought to bind to a histone modification site that regulates gene expression. Mutations in this gene have been associated with autosomal recessive dilated cardiomyopathy. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jun 2012]

Research Articles on GATAD1

Similar Products

Product Notes

The GATAD1 gatad1 (Catalog #AAA3201376) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GATAD1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GATAD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GATAD1 gatad1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KMEYLEFVCH APSEYFKSRS SPFPTVPTRP EKGYIWTHVG PTPAITIKES. It is sometimes possible for the material contained within the vial of "GATAD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.