Cyclin-G-associated kinase (Gak) Recombinant Protein | Gak recombinant protein
Recombinant Rat Cyclin-G-associated kinase (Gak) , partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cyclin-G-associated kinase (Gak); Recombinant Rat Cyclin-G-associated kinase (Gak); partial; Gak recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
40-315, partial, provide the Protein kinase domain.
Sequence
LRVRRVLAEGGFAFVYEAQDLGSGREYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLRRVECKGPLSCDSILKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPDYSWSAQKRAMVEEEITRNTTPMYRTPEIVDLYSNFPIGEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPVNDTRYTVFHDLIRGMLKVNPEERLSIAEVVRQLQE
Sequence Length
315
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Gak recombinant protein
In all eukaryotes, the cell cycle is governed by cyclin-dependent protein kinases (CDKs), whose activities are regulated by cyclins and CDK inhibitors in a diverse array of mechanisms that involve the control of phosphorylation and dephosphorylation of Ser, Thr or Tyr residues. Cyclins are molecules that possess a consensus domain called the cyclin box. In mammalian cells, 9 cyclin species have been identified, and they are referred to as cyclins A through I. Cyclin G is a direct transcriptional target of the p53 tumor suppressor gene product and thus functions downstream of p53. GAK is an association partner of cyclin G and CDK5.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
143,703 Da
NCBI Official Full Name
cyclin-G-associated kinase
NCBI Official Synonym Full Names
cyclin G associated kinase
NCBI Official Symbol
Gak
NCBI Protein Information
cyclin-G-associated kinase
UniProt Protein Name
Cyclin-G-associated kinase
Protein Family
UniProt Gene Name
Gak
NCBI Description
may be a serine/threonine protein kinase; may be involved with nucleotide metabolism [RGD, Feb 2006]
Uniprot Description
Associates with cyclin G and CDK5. Seems to act as an auxilin homolog that is involved in the uncoating of clathrin-coated vesicles by Hsc70 in non-neuronal cells. Expression oscillates slightly during the cell cycle, peaking at G1 ().
Research Articles on Gak
Similar Products
Product Notes
The Gak gak (Catalog #AAA958740) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 40-315, partial, provide the Protein kinase domain. The amino acid sequence is listed below: LRVRRVLAEG GFAFVYEAQD LGSGREYALK RLLSNEEEKN RAIIQEVCFL KKLSGHPNIV QFCSAASIGK EESDTGQAEF LLLTELCKGQ LVEFLRRVEC KGPLSCDSIL KIFYQTCRAV QHMHRQKPPI IHRDLKVENL LLSNQGTIKL CDFGSATTIS HYPDYSWSAQ KRAMVEEEIT RNTTPMYRTP EIVDLYSNFP IGEKQDIWAL GCILYLLCFR QHPFEDGAKL RIVNGKYSIP VNDTRYTVFH DLIRGMLKVN PEERLSIAEV VRQLQE . It is sometimes possible for the material contained within the vial of "Cyclin-G-associated kinase (Gak), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
