Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Glycoprotein G (G) Recombinant Protein | RABVgp4 recombinant protein

Recombinant Rabies virus Glycoprotein G (G)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glycoprotein G (G); Recombinant Rabies virus Glycoprotein G (G); Recombinant Glycoprotein G (G); Glycoprotein G; RABVgp4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-459. Partial, provide the Virion surface domain
Sequence
KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYISAIKMNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVKTTKESLVIISPSVADLDPYDRSLHSRVFPGGNCSGVAVSSTYCSTNHDYTIWMPENPRLGMSCDIFTNSRGKRASKGSETCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSNETKWCPPGQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLRVGGRCHPHVNGVFFNGIILGPDGNVLIPEMQSSLLQQHMELLVSSVIPLMHPLADPSTVFKNGDEAEDFVEVHLPDVHERISGVDLGLPNWGKY
Sequence Length
459
Species
Rabies virus (strain Pasteur vaccins / PV) (RABV)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

SDS-PAGE
Related Product Information for RABVgp4 recombinant protein
Attaches the virus to host cellular receptor, inducing endocytosis of the virion. In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell membrane. There is convincing in vitro evidence that the muscular form of the nicotinic acetylcholine receptor (nAChR), the neuronal cell adhesion molecule (NCAM), and the p75 neurotrophin receptor (p75NTR) bind glycoprotein G and thereby facilitate rabies virus entry into cells .

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kD
NCBI Official Full Name
transmembrane glycoprotein G
NCBI Official Symbol
RABVgp4
NCBI Protein Information
transmembrane glycoprotein G
UniProt Protein Name
Glycoprotein G
UniProt Gene Name
G
UniProt Entry Name
VGLG_RABVP

Uniprot Description

Function: Attaches the virus to host cellular receptor, inducing endocytosis of the virion. In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell membrane. There is convincing in vitro evidence that the muscular form of the nicotinic acetylcholine receptor (nAChR), the neuronal cell adhesion molecule (NCAM), and the p75 neurotrophin receptor (p75NTR) bind glycoprotein G and thereby facilitate rabies virus entry into cells

By similarity.

Subunit structure: Homotrimer. Interacts with matrix protein

By similarity.

Subcellular location: Virion membrane; Single-pass type I membrane protein

Potential.

Post-translational modification: Glycosylated and palmitoylated by host. Glycosylation is crucial for glycoprotein export at the cell surface

By similarity.

Biotechnological use: Primary surface antigen capable of inducing and reacting with virus-neutralizing antibodies. Almost all human and veterinary vaccines are based on the functional aspects of the G protein.

Miscellaneous: Arg-352 is highly involved in rabies virus pathogenicity. Its mutation dramatically attenuates the virus

By similarity.

Sequence similarities: Belongs to the lyssavirus glycoprotein family.

Research Articles on RABVgp4

Similar Products

Product Notes

The RABVgp4 g (Catalog #AAA1005806) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-459. Partial, provide the Virion surface domain. The amino acid sequence is listed below: KFPIYTIPDK LGPWSPIDIH HLSCPNNLVV EDEGCTNLSG FSYMELKVGY ISAIKMNGFT CTGVVTEAET YTNFVGYVTT TFKRKHFRPT PDACRAAYNW KMAGDPRYEE SLHNPYPDYH WLRTVKTTKE SLVIISPSVA DLDPYDRSLH SRVFPGGNCS GVAVSSTYCS TNHDYTIWMP ENPRLGMSCD IFTNSRGKRA SKGSETCGFV DERGLYKSLK GACKLKLCGV LGLRLMDGTW VAMQTSNETK WCPPGQLVNL HDFRSDEIEH LVVEELVKKR EECLDALESI MTTKSVSFRR LSHLRKLVPG FGKAYTIFNK TLMEADAHYK SVRTWNEIIP SKGCLRVGGR CHPHVNGVFF NGIILGPDGN VLIPEMQSSL LQQHMELLVS SVIPLMHPLA DPSTVFKNGD EAEDFVEVHL PDVHERISGV DLGLPNWGKY. It is sometimes possible for the material contained within the vial of "Glycoprotein G (G), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.