Frizzled (fz) Recombinant Protein | fz recombinant protein
Recombinant Drosophila virilis Frizzled (fz)
Gene Names
Dvirfz; DvirGJ11377; dvir_GLEANR_11420; fz; GJ11377
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Frizzled (fz); Recombinant Drosophila virilis Frizzled (fz); fz recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
18-580aa; full length protein
Sequence
AQRYDQTPLDASSYYRSDLTGSSASSLDGFPHHNRCEPITISICKNIPYNMTIMPNLIGH TKQEEAGLEVHQFAPLVKIGCSADLQLFLCSLYVPVCTILERPIPPCRSLCESARVCETL MKTYNFNWPENLECSKFPVHGGEDLCVAENTTASSSTPAPTRSAPKVTTRKHQISVDSPH RNIGFVCPVQLKTPLGMGYELKVGGKDLHDCGAPCHAMFFPERERTVLRYWVGSWAAICV ASCLFTVLTFLIDSSRFRYPERAIVFLAVCYLVVGCAYVAGLGAGDSVSCREPFPPPVKL GRLQMMSTITQGHRQTTACTVLFMALYFCCMAAFAWWSCLAFAWFLAAGLKWGHEAIENK SHLFHLVAWAVPALQTISVLALAKVEGDILSGVCFVGQLDTHSLGGFLILPLCIYLSIGA LFLLAGFISLFRIRTVMKTDGKRTDKLERLMLRIGFFSGLFILPALGLLGCLFYEYYNFD EWMIQWHRDICKPFSIPCPAARPPGTPEARPIFQIYMVKYLCSMLVGVTSSVWLYSSKTM VSWRNFVERLQGKEPRTRAQAYV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Drosophila virilis (Fruit fly)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for fz recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
64,709 Da
NCBI Official Full Name
frizzled
NCBI Official Synonym Full Names
frizzled
NCBI Official Symbol
Dvirfz
NCBI Official Synonym Symbols
DvirGJ11377; dvir_GLEANR_11420; fz; GJ11377
NCBI Protein Information
GJ11377 gene product from transcript GJ11377-RA
UniProt Protein Name
Frizzled
UniProt Gene Name
fz
UniProt Synonym Gene Names
dFz1
UniProt Entry Name
FRIZ_DROVI
Uniprot Description
Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. Required to coordinate the cytoskeletons of epidermal cells to produce a parallel array of cuticular hairs and bristles.
Similar Products
Product Notes
The fz fz (Catalog #AAA7015383) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-580aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the fz fz for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AQRYDQTPLD ASSYYRSDLT GSSASSLDGF PHHNRCEPIT ISICKNIPYN MTIMPNLIGH TKQEEAGLEV HQFAPLVKIG CSADLQLFLC SLYVPVCTIL ERPIPPCRSL CESARVCETL MKTYNFNWPE NLECSKFPVH GGEDLCVAEN TTASSSTPAP TRSAPKVTTR KHQISVDSPH RNIGFVCPVQ LKTPLGMGYE LKVGGKDLHD CGAPCHAMFF PERERTVLRY WVGSWAAICV ASCLFTVLTF LIDSSRFRYP ERAIVFLAVC YLVVGCAYVA GLGAGDSVSC REPFPPPVKL GRLQMMSTIT QGHRQTTACT VLFMALYFCC MAAFAWWSCL AFAWFLAAGL KWGHEAIENK SHLFHLVAWA VPALQTISVL ALAKVEGDIL SGVCFVGQLD THSLGGFLIL PLCIYLSIGA LFLLAGFISL FRIRTVMKTD GKRTDKLERL MLRIGFFSGL FILPALGLLG CLFYEYYNFD EWMIQWHRDI CKPFSIPCPA ARPPGTPEAR PIFQIYMVKY LCSMLVGVTS SVWLYSSKTM VSWRNFVERL QGKEPRTRAQ AYV. It is sometimes possible for the material contained within the vial of "Frizzled (fz), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
