Sodium/potassium-transporting ATPase subunit gamma (FXYD2) Recombinant Protein | FXYD2 recombinant protein

Recombinant Human Sodium/potassium-transporting ATPase subunit gamma (FXYD2)

Cat. Num. AAA957538

• Gene Names: FXYD2; HOMG2; ATP1G1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Sodium/potassium-transporting ATPase subunit gamma (FXYD2); Recombinant Human Sodium/potassium-transporting ATPase subunit gamma (FXYD2); Recombinant Sodium/potassium-transporting ATPase subunit gamma (FXYD2); Sodium/potassium-transporting ATPase subunit gamma; Na(+)/K(+) ATPase subunit gamma; FXYD domain-containing ion transport regulator 2 Sodium pump gamma chain; FXYD2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-64aa; Full Length of Isoform 2
• Sequence: MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP
• Sequence Length: 66

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

SDS-PAGE

Related Product Information for FXYD2 recombinant protein

May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase.

Product Categories/Family for FXYD2 recombinant protein

Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 11125766
• NCBI GeneID: 486
• NCBI Accession #: NP_001671.2
• NCBI GenBank Nucleotide #: NM_001680.4
• UniProt Accession #: P54710; Q15332; Q53YC1; Q9GZP3; Q9GZQ7
• Molecular Weight: 34.4 kDa
• NCBI Official Full Name: sodium/potassium-transporting ATPase subunit gamma isoform 1
• NCBI Official Synonym Full Names: FXYD domain containing ion transport regulator 2
• NCBI Official Symbol: FXYD2
• NCBI Official Synonym Symbols: HOMG2; ATP1G1
• NCBI Protein Information: sodium/potassium-transporting ATPase subunit gamma; sodium pump gamma chain; Na(+)/K(+) ATPase subunit gamma; ATPase, Na+/K+ transporting, gamma 1 polypeptide
• UniProt Protein Name: Sodium/potassium-transporting ATPase subunit gamma
• Protein Family: Sodium/potassium-transporting ATPase
• UniProt Gene Name: FXYD2
• UniProt Synonym Gene Names: ATP1C; ATP1G1; Na(+)/K(+) ATPase subunit gamma
• UniProt Entry Name: ATNG_HUMAN

NCBI Description

This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.[provided by RefSeq, Feb 2011]

Uniprot Description

FXYD2: May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase. Defects in FXYD2 are the cause of hypomagnesemia type 2 (HOMG2); also known as dominant renal hypomagnesemia or hypomagnesemia with hypocalciuria. HOMG2 is a disorder due to primary renal wasting of magnesium. Plasma levels of other electrolytes are normal. The only abnormality found, in addition to low magnesium levels, is lowered renal excretion of calcium resulting in hypocalciuria. Belongs to the FXYD family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q23

Cellular Component: intracellular membrane-bound organelle; basolateral plasma membrane; plasma membrane; sodium:potassium-exchanging ATPase complex

Molecular Function: transporter activity; ion channel activity; sodium:potassium-exchanging ATPase activity

Biological Process: transport; regulation of cell growth; transmembrane transport; potassium ion transport; regulation of cell proliferation

Disease: Hypomagnesemia 2, Renal