Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.78kD).)

Mouse anti-Human FXYD Domain Containing Ion Transport Regulator 2 Monoclonal Antibody | anti-FXYD2 antibody

FXYD Domain Containing Ion Transport Regulator 2 (FXYD2, ATP1C, ATP1G1, HOMG2, MGC12372, Sodium/potassium-transporting ATPase Subunit gamma, Na(+)/K(+) ATPase Subunit gamma, Sodium Pump gamma Chain)

Gene Names
FXYD2; HOMG2; ATP1G1
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
FXYD Domain Containing Ion Transport Regulator 2; Monoclonal Antibody; FXYD Domain Containing Ion Transport Regulator 2 (FXYD2; ATP1C; ATP1G1; HOMG2; MGC12372; Sodium/potassium-transporting ATPase Subunit gamma; Na(+)/K(+) ATPase Subunit gamma; Sodium Pump gamma Chain); Anti -FXYD Domain Containing Ion Transport Regulator 2 (FXYD2; anti-FXYD2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1C3-B3
Specificity
Recognizes human FXYD2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP
Applicable Applications for anti-FXYD2 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Full length recombinant corresponding to aa1-64 from human FXYD2 (AAH05302.1) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.78kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.78kD).)

Western Blot (WB)

(FXYD2 monoclonal antibody Western Blot analysis of FXYD2 expression in Jurkat.)

Western Blot (WB) (FXYD2 monoclonal antibody Western Blot analysis of FXYD2 expression in Jurkat.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to FXYD2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to FXYD2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml].)
Product Categories/Family for anti-FXYD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
486
UniProt Accession #
Molecular Weight
7,283 Da
NCBI Official Full Name
FXYD domain containing ion transport regulator 2
NCBI Official Synonym Full Names
FXYD domain containing ion transport regulator 2
NCBI Official Symbol
FXYD2
NCBI Official Synonym Symbols
HOMG2; ATP1G1
NCBI Protein Information
sodium/potassium-transporting ATPase subunit gamma; sodium pump gamma chain; Na(+)/K(+) ATPase subunit gamma; ATPase, Na+/K+ transporting, gamma 1 polypeptide
UniProt Protein Name
Sodium/potassium-transporting ATPase subunit gamma
UniProt Gene Name
FXYD2
UniProt Synonym Gene Names
ATP1C; ATP1G1; Na(+)/K(+) ATPase subunit gamma
UniProt Entry Name
ATNG_HUMAN

NCBI Description

This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.[provided by RefSeq, Feb 2011]

Uniprot Description

Function: May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase.

Subunit structure: Composed of three subunits: alpha (catalytic), beta and gamma.

Subcellular location: Membrane; Single-pass type III membrane protein

Potential.

Tissue specificity: Expressed in the distal convoluted tubule in the kidney. Found on basolateral membranes of nephron epithelial cells.

Involvement in disease: Hypomagnesemia 2 (HOMG2) [MIM:154020]: A disorder due to primary renal wasting of magnesium. Plasma levels of other electrolytes are normal. The only abnormality found, in addition to low magnesium levels, is lowered renal excretion of calcium resulting in hypocalciuria.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.3

Sequence similarities: Belongs to the FXYD family.

Sequence caution: The sequence AAB09425.1 differs from that shown. Reason: Frameshift at position 12. The sequence CAA60152.1 differs from that shown. Reason: Erroneous translation. Wrong choice of frame.

Research Articles on FXYD2

Similar Products

Product Notes

The FXYD2 fxyd2 (Catalog #AAA649576) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FXYD Domain Containing Ion Transport Regulator 2 (FXYD2, ATP1C, ATP1G1, HOMG2, MGC12372, Sodium/potassium-transporting ATPase Subunit gamma, Na(+)/K(+) ATPase Subunit gamma, Sodium Pump gamma Chain) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FXYD Domain Containing Ion Transport Regulator 2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the FXYD2 fxyd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDRWYLGGSP KGDVDPFYYD YETVRNGGLI FAGLAFIVGL LILLSRRFRC GGNKKRRQIN EDEP. It is sometimes possible for the material contained within the vial of "FXYD Domain Containing Ion Transport Regulator 2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.