Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cell division ATP-binding protein FtsE (ftsE) Recombinant Protein | ftsE recombinant protein

Recombinant Bacillus subtilis Cell division ATP-binding protein FtsE (ftsE)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cell division ATP-binding protein FtsE (ftsE); Recombinant Bacillus subtilis Cell division ATP-binding protein FtsE (ftsE); ftsE recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-228, Full length protein
Sequence
MIEMKEVYKAYPNGVKALNGISVTIHPGEFVYVVGPSGAGKSTFIKMIYREEKPTKGQILINHKDLATIKEKEIPFVRRKIGVVFQDFKLLPKLTVFENVAFALEVIGEQPSVIKKRVLEVLDLVQLKHKARQFPDQLSGGEQQRVSIARSIVNNPDVVIADEPTGNLDPDTSWEVMKTLEEINNRGTTVVMATHNKEIVNTMKKRVIAIEDGIIVRDESRGEYGSYD
Sequence Length
228
Species
Bacillus subtilis (strain 168)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,620 Da
NCBI Official Full Name
cell division ATP-binding protein FtsE
NCBI Official Symbol
ftsE
NCBI Protein Information
cell division ATP-binding protein FtsE
UniProt Protein Name
Cell division ATP-binding protein FtsE
UniProt Gene Name
ftsE

Uniprot Description

Part of the ABC transporter FtsEX involved in sporulation. May act as an importer, possibly at the top of a hierarchical cascade leading to the correct temporal initiation of sporulation. Acts upstream of the histidine kinases KinA, KinB and KinC, the RapA phosphatase and the Spo0A sporulation protein.

Research Articles on ftsE

Similar Products

Product Notes

The ftsE ftse (Catalog #AAA1186695) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-228, Full length protein. The amino acid sequence is listed below: MIEMKEVYKA YPNGVKALNG ISVTIHPGEF VYVVGPSGAG KSTFIKMIYR EEKPTKGQIL INHKDLATIK EKEIPFVRRK IGVVFQDFKL LPKLTVFENV AFALEVIGEQ PSVIKKRVLE VLDLVQLKHK ARQFPDQLSG GEQQRVSIAR SIVNNPDVVI ADEPTGNLDP DTSWEVMKTL EEINNRGTTV VMATHNKEIV NTMKKRVIAI EDGIIVRDES RGEYGSYD. It is sometimes possible for the material contained within the vial of "Cell division ATP-binding protein FtsE (ftsE), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.