Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

F-box/SPRY domain-containing protein 1 (Fsn) Recombinant Protein | Fsn recombinant protein

Recombinant Aedes aegypti F-box/SPRY domain-containing protein 1 (Fsn)

Gene Names
LOC5571026; Fsn; AAEL008758
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
F-box/SPRY domain-containing protein 1 (Fsn); Recombinant Aedes aegypti F-box/SPRY domain-containing protein 1 (Fsn); Fsn recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-258, full length protein
Sequence
MDDDLTEYAPDIPDNVLELIFSYLKLQDLRNCSLVCKSWNRFLNDENNEVWRAQCMQKLSPDAFKTDLLSVVPTYKAKLRAFFHAWNPYDCSRHVYIKPNGFTLHRNPVAQSTDGSRGKIGFQHGRHAWEVRWEGPLGTVAVVGIATKDAAIQCHGYYALLGADDQSWGWNLVDNLLLHNGDAHGIYPLLNNAPKYKVGERIRVILDCDDNTLSFEKNYEFLGVAFTDLPDKVFYPTVAAVYGNTEISMVYLGPPLDG
Sequence Length
258
Species
Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,206 Da
NCBI Official Full Name
AAEL008758-PA
NCBI Official Symbol
LOC5571026
NCBI Official Synonym Symbols
Fsn; AAEL008758
NCBI Protein Information
F-box/SPRY domain-containing protein 1
UniProt Protein Name
F-box/SPRY domain-containing protein 1
UniProt Gene Name
Fsn

Uniprot Description

Required in the presynaptic motoneuron to down-regulate the levels of wnd and restrain synaptic terminal growth at the neuromuscular junction (NMJ).

Similar Products

Product Notes

The Fsn fsn (Catalog #AAA1449306) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-258, full length protein. The amino acid sequence is listed below: MDDDLTEYAP DIPDNVLELI FSYLKLQDLR NCSLVCKSWN RFLNDENNEV WRAQCMQKLS PDAFKTDLLS VVPTYKAKLR AFFHAWNPYD CSRHVYIKPN GFTLHRNPVA QSTDGSRGKI GFQHGRHAWE VRWEGPLGTV AVVGIATKDA AIQCHGYYAL LGADDQSWGW NLVDNLLLHN GDAHGIYPLL NNAPKYKVGE RIRVILDCDD NTLSFEKNYE FLGVAFTDLP DKVFYPTVAA VYGNTEISMV YLGPPLDG. It is sometimes possible for the material contained within the vial of "F-box/SPRY domain-containing protein 1 (Fsn), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.