Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Follicle-stimulating hormone receptor (Fshr) Recombinant Protein | Fshr recombinant protein

Recombinant Rat Follicle-stimulating hormone receptor (Fshr)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Follicle-stimulating hormone receptor (Fshr); Recombinant Rat Follicle-stimulating hormone receptor (Fshr); Fshr recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
18-692aa; Full length protein
Sequence
CHHWLCHCSNRVFLCQDSKVTEIPTDLPRNAIELRFVLTKLRVIPKGSFAGFGDLEKIEI SQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPSLRYLLISNTGIKHLPA VHKIQSLQKVLLDIQDNINIHIVARNSFMGLSFESVILWLSKNGIEEIHNCAFNGTQLDE LNLSDNNNLEELPNDVFQGASGPVILDISRTKVHSLPNHGLENLKKLRARSTYRLKKLPN LDKFVTLMEASLTYPSHCCAFANLKRQISELHPICNKSILRQDIDDMTQIGDQRVSLIDD EPSYGKGSDMMYNEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILRVLIWFISILAIT GNTTVLVVLTTSQYKLTVPRFLMCNLAFADLCIGIYLLLIASVDIHTKSQYHNYAIDWQT GAGCDAAGFFTVFASELSVYTLTAITLERWHTITHAMQLECKVQLRHAASVMVLGWTFAF AAALFPIFGISSYMKVSICLPMDIDSPLSQLYVMALLVLNVLAFVVICGCYTHIYLTVRN PTIVSSSSDTKIAKRMATLIFTDFLCMAPISFFAISASLKVPLITVSKAKILLVLFYPIN SCANPFLYAIFTKNFRRDFFILLSKFGCYEMQAQIYRTETSSATHNFHARKSHCSSAPRV TNSYVLVPLNHSSQN
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Fshr recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77,681 Da
NCBI Official Full Name
follicle-stimulating hormone receptor
NCBI Official Synonym Full Names
follicle stimulating hormone receptor
NCBI Official Symbol
Fshr
NCBI Protein Information
follicle-stimulating hormone receptor
UniProt Protein Name
Follicle-stimulating hormone receptor
UniProt Gene Name
Fshr
UniProt Synonym Gene Names
FSH-R
UniProt Entry Name
FSHR_RAT

NCBI Description

testicular receptor for follicle stimulating hormone; stimulates adenylyl cyclase activity [RGD, Feb 2006]

Uniprot Description

FSHR: Receptor for follicle-stimulating hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Defects in FSHR are a cause of ovarian dysgenesis type 1 (ODG1); also known as premature ovarian failure or gonadal dysgenesis XX type or XX gonadal dysgenesis (XXGD) or hereditary hypergonadotropic ovarian failure or hypergonadotropic ovarian dysgenesis with normal karyotype. ODG1 is an autosomal recessive disease characterized by primary amenorrhea, variable development of secondary sex characteristics, and high serum levels of follicle-stimulating hormone (FSH) and luteinizing hormone (LH). Defects in FSHR are a cause of ovarian hyperstimulation syndrome (OHSS). OHSS is a disorder which occurs either spontaneously or most often as an iatrogenic complication of ovarian stimulation treatments for in vitro fertilization. The clinical manifestations vary from abdominal distention and discomfort to potentially life-threatening, massive ovarian enlargement and capillary leak with fluid sequestration. Pathologic features of this syndrome include the presence of multiple serous and hemorrhagic follicular cysts lined by luteinized cells, a condition called hyperreactio luteinalis. Belongs to the G-protein coupled receptor 1 family. FSH/LSH/TSH subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; GPCR, family 1; Membrane protein, integral; Receptor, GPCR

Cellular Component: cell surface; endosome; integral to plasma membrane

Molecular Function: follicle-stimulating hormone receptor activity; G-protein coupled receptor activity; peptide hormone binding; peptide receptor activity, G-protein coupled; protein binding

Biological Process: adenylate cyclase activation; cellular water homeostasis; follicle-stimulating hormone signaling pathway; G-protein signaling, adenylate cyclase activating pathway; G-protein signaling, adenylate cyclase inhibiting pathway; G-protein signaling, coupled to cAMP nucleotide second messenger; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); hormone-mediated signaling; locomotory behavior; male gonad development; negative regulation of bone resorption; neurite development; ovarian follicle development; ovulation cycle process; positive regulation of estrogen receptor signaling pathway; positive regulation of phosphoinositide 3-kinase cascade; primary ovarian follicle growth; regulation of chromosome organization and biogenesis; regulation of estrogen receptor signaling pathway; regulation of hormone metabolic process; regulation of MAPKKK cascade; regulation of osteoclast differentiation; regulation of protein amino acid phosphorylation; regulation of systemic arterial blood pressure; Sertoli cell development; Sertoli cell proliferation; sperm chromatin condensation; spermatid development; spermatogenesis; spermatogenesis, exchange of chromosomal proteins; transcytosis; uterus development

Research Articles on Fshr

Similar Products

Product Notes

The Fshr fshr (Catalog #AAA7015213) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-692aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Fshr fshr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CHHWLCHCSN RVFLCQDSKV TEIPTDLPRN AIELRFVLTK LRVIPKGSFA GFGDLEKIEI SQNDVLEVIE ADVFSNLPKL HEIRIEKANN LLYINPEAFQ NLPSLRYLLI SNTGIKHLPA VHKIQSLQKV LLDIQDNINI HIVARNSFMG LSFESVILWL SKNGIEEIHN CAFNGTQLDE LNLSDNNNLE ELPNDVFQGA SGPVILDISR TKVHSLPNHG LENLKKLRAR STYRLKKLPN LDKFVTLMEA SLTYPSHCCA FANLKRQISE LHPICNKSIL RQDIDDMTQI GDQRVSLIDD EPSYGKGSDM MYNEFDYDLC NEVVDVTCSP KPDAFNPCED IMGYNILRVL IWFISILAIT GNTTVLVVLT TSQYKLTVPR FLMCNLAFAD LCIGIYLLLI ASVDIHTKSQ YHNYAIDWQT GAGCDAAGFF TVFASELSVY TLTAITLERW HTITHAMQLE CKVQLRHAAS VMVLGWTFAF AAALFPIFGI SSYMKVSICL PMDIDSPLSQ LYVMALLVLN VLAFVVICGC YTHIYLTVRN PTIVSSSSDT KIAKRMATLI FTDFLCMAPI SFFAISASLK VPLITVSKAK ILLVLFYPIN SCANPFLYAI FTKNFRRDFF ILLSKFGCYE MQAQIYRTET SSATHNFHAR KSHCSSAPRV TNSYVLVPLN HSSQN. It is sometimes possible for the material contained within the vial of "Follicle-stimulating hormone receptor (Fshr), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.