Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Folate receptor beta (FOLR2) Recombinant Protein | FOLR2 recombinant protein

Recombinant Human Folate receptor beta (FOLR2), partial

Gene Names
FOLR2; FBP; FR-P3; FR-BETA; BETA-HFR; FBP/PL-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Folate receptor beta (FOLR2); Recombinant Human Folate receptor beta (FOLR2); partial; Folate receptor 2; Folate receptor; fetal/placental; Placental folate-binding protein; FOLR2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-230aa; Partial
Sequence
CSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN
Sequence Length
Partial
Organism
Homo sapiens (Human)
Tag Information
N-terminal 10xHis-tagged
Production Note
Special Offer: The Baculovirus host-expressed protein is manufactured from a stock plasmid containing the protein gene. Baculovirushost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Baculovirus host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Baculovirus host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.
The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

SDS-Page
Related Product Information for FOLR2 recombinant protein
Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release.
Product Categories/Family for FOLR2 recombinant protein
References
"Folate coenzyme and antifolate transport proteins in normal and neoplastic cells." Freisheim J.H., Price E.M., Ratnam M.Adv. Enzyme Regul. 29:13-26 (1989)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27.1 kDa
NCBI Official Full Name
folate receptor beta
NCBI Official Synonym Full Names
folate receptor beta
NCBI Official Symbol
FOLR2
NCBI Official Synonym Symbols
FBP; FR-P3; FR-BETA; BETA-HFR; FBP/PL-1
NCBI Protein Information
folate receptor beta
UniProt Protein Name
Folate receptor beta
Protein Family
UniProt Gene Name
FOLR2
UniProt Synonym Gene Names
FR-beta; FBP

NCBI Description

The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid arthritis patients. Multiple transcript variants that encode the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release.

Research Articles on FOLR2

Similar Products

Product Notes

The FOLR2 folr2 (Catalog #AAA7110801) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-230aa; Partial with tag N-terminal 10xHis-tagged. The amino acid sequence is listed below: CSAQDRTDLL NVCMDAKHHK TKPGPEDKLH DQCSPWKKNA CCTASTSQEL HKDTSRLYNF NWDHCGKMEP ACKRHFIQDT CLYECSPNLG PWIQQVNQSW RKERFLDVPL CKEDCQRWWE DCHTSHTCKS NWHRGWDWTS GVNKCPAGAL CRTFESYFPT PAALCEGLWS HSYKVSNYSR GSGRCIQMWF DSAQGNPNEE VARFYAAAMH VN. It is sometimes possible for the material contained within the vial of "Folate receptor beta (FOLR2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.