Peptidyl-prolyl cis-trans isomerase FKBP1A (Fkbp1a) Recombinant Protein | Fkbp1a recombinant protein

Recombinant Mouse Peptidyl-prolyl cis-trans isomerase FKBP1A (Fkbp1a)

Cat. Num. AAA957052

• Gene Names: Fkbp1a; Fkbp; Fkbp1; FKBP12
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Peptidyl-prolyl cis-trans isomerase FKBP1A (Fkbp1a); Recombinant Mouse Peptidyl-prolyl cis-trans isomerase FKBP1A (Fkbp1a); Fkbp1a recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-108, Full length protein
• Sequence: GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQRAKLIISSDYAYGATGHPGIIPPHATLVFDVELLKLE
• Sequence Length: 107

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Fkbp1a recombinant protein

This protein is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed.

NCBI and Uniprot Product Information

• NCBI GI #: 689972333
• NCBI GeneID: 14225
• NCBI Accession #: NP_001289006.1
• NCBI GenBank Nucleotide #: NM_001302077.1
• UniProt Accession #: P26883; Q545E9
• Molecular Weight: 11,923 Da
• NCBI Official Full Name: peptidyl-prolyl cis-trans isomerase FKBP1A isoform 1
• NCBI Official Synonym Full Names: FK506 binding protein 1a
• NCBI Official Symbol: Fkbp1a
• NCBI Official Synonym Symbols: Fkbp; Fkbp1; FKBP12
• NCBI Protein Information: peptidyl-prolyl cis-trans isomerase FKBP1A
• UniProt Protein Name: Peptidyl-prolyl cis-trans isomerase FKBP1A
• Protein Family: Peptidyl-prolyl cis-trans isomerase
• UniProt Gene Name: Fkbp1a
• UniProt Synonym Gene Names: Fkbp1; PPIase FKBP1A; 12 kDa FKBP; FKBP-12; FKBP-1A

NCBI Description

This gene is a member of the immunophilin family. The encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, and is associated with immunoregulation, protein folding, receptor signaling, protein trafficking and T-cell activation. It may modulate the calcium release activity of the ryanodine receptor Ryr1. It also interacts with the type I TGF-beta receptor. Disruption of this gene in mouse causes severe ventricular defects. Pseudogenes of this gene have been defined on chromosomes 4, 10, 14, and 16. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2014]

Uniprot Description

Keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand. Recruits SMAD7 to ACVR1B which prevents the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. May modulate the RYR1 calcium channel activity. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides ().