Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Four and a half LIM domains protein 3 (FHL3) Recombinant Protein | FHL3 recombinant protein

Recombinant Human Four and a half LIM domains protein 3 (FHL3)

Gene Names
FHL3; SLIM2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Four and a half LIM domains protein 3 (FHL3); Recombinant Human Four and a half LIM domains protein 3 (FHL3); Four and a half LIM domains protein 3; FHL-3; Skeletal muscle LIM-protein 2; SLIM-2; FHL3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-280aa; Full Length
Sequence
SESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP
Sequence Length
279
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Product Categories/Family for FHL3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58.1 kDa
NCBI Official Full Name
four and a half LIM domains protein 3 isoform 2
NCBI Official Synonym Full Names
four and a half LIM domains 3
NCBI Official Symbol
FHL3
NCBI Official Synonym Symbols
SLIM2
NCBI Protein Information
four and a half LIM domains protein 3; FHL-3; SLIM-2; LIM-only protein FHL3; skeletal muscle LIM-protein 2
UniProt Protein Name
Four and a half LIM domains protein 3
UniProt Gene Name
FHL3
UniProt Synonym Gene Names
SLIM2; FHL-3; SLIM-2
UniProt Entry Name
FHL3_HUMAN

NCBI Description

The protein encoded by this gene is a member of a family of proteins containing a four-and-a-half LIM domain, which is a highly conserved double zinc finger motif. The encoded protein has been shown to interact with the cancer developmental regulators SMAD2, SMAD3, and SMAD4, the skeletal muscle myogenesis protein MyoD, and the high-affinity IgE beta chain regulator MZF-1. This protein may be involved in tumor suppression, repression of MyoD expression, and repression of IgE receptor expression. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]

Uniprot Description

FHL3:

Protein type: Contractile; Actin-binding

Chromosomal Location of Human Ortholog: 1p34

Cellular Component: focal adhesion; stress fiber; nucleus; Z disc

Molecular Function: zinc ion binding; actin binding

Biological Process: muscle development; actin cytoskeleton organization and biogenesis

Research Articles on FHL3

Similar Products

Product Notes

The FHL3 fhl3 (Catalog #AAA1376227) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-280aa; Full Length. The amino acid sequence is listed below: SESFDCAKCN ESLYGRKYIQ TDSGPYCVPC YDNTFANTCA ECQQLIGHDS RELFYEDRHF HEGCFRCCRC QRSLADEPFT CQDSELLCND CYCSAFSSQC SACGETVMPG SRKLEYGGQT WHEHCFLCSG CEQPLGSRSF VPDKGAHYCV PCYENKFAPR CARCSKTLTQ GGVTYRDQPW HRECLVCTGC QTPLAGQQFT SRDEDPYCVA CFGELFAPKC SSCKRPIVGL GGGKYVSFED RHWHHNCFSC ARCSTSLVGQ GFVPDGDQVL CQGCSQAGP. It is sometimes possible for the material contained within the vial of "Four and a half LIM domains protein 3 (FHL3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.