Mouse RARA Monoclonal Antibody | anti-RARA antibody

RARA (Retinoic Acid Receptor, alpha, NR1B1, RAR) (APC)

Cat. Num. AAA6166673

• Gene Names: RARA; RAR; NR1B1
• Applications: Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: RARA; Monoclonal Antibody; RARA (Retinoic Acid Receptor; alpha; NR1B1; RAR) (APC); Retinoic Acid Receptor; RAR; anti-RARA antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2D2
• Specificity: Recognizes RARA.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-RARA antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: RARA (NP_000955, 315aa-424aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLS
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to RARA on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.2 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RARA on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.2 ug/ml])

Western Blot (WB)

(RARA monoclonal antibody (M03), clone 2D2 Western Blot analysis of RARA expression in Hela S3 NE.)

Testing Data

(Detection limit for recombinant GST tagged RARA is approximately 1ng/ml as a capture antibody.)

Related Product Information for anti-RARA antibody

Retinoid signaling is transduced by 2 families of nuclear receptors, retinoic acid receptor (RAR) and retinoid X receptor (RXR; see MIM 180245), which form RXR/RAR heterodimers. In the absence of ligand, DNA-bound RXR/RARA represses transcription by recruiting the corepressors NCOR1 (MIM 600849), SMRT (NCOR2; MIM 600848), and histone deacetylase (see MIM 601241). When ligand binds to the complex, it induces a conformational change allowing the recruitment of coactivators, histone acetyltransferases (see MIM 603053), and the basic transcription machinery. Translocations that always involve rearrangement of the RARA gene are a cardinal feature of acute promyelocytic leukemia (APL; MIM 612376). The most frequent translocation is t(15,17)(q21;q22), which fuses the RARA gene with the PML gene (MIM 102578) (Vitoux et al., 2007 [PubMed 17468032]). [supplied by OMIM]

Product Categories/Family for anti-RARA antibody

Antibodies; Receptors

References

1. Moz and Retinoic Acid Coordinately Regulate H3K9 Acetylation, Hox Gene Expression, and Segment Identity. Voss AK, Collin C, Dixon MP, Thomas T.Dev Cell. 2009 Nov;17(5):674-86.

NCBI and Uniprot Product Information

• NCBI GI #: 4506419
• NCBI GeneID: 5914
• NCBI Accession #: NP_000955
• NCBI GenBank Nucleotide #: NM_000964.3
• UniProt Accession #: P10276; P78456; Q13440; Q13441; Q96S41; Q9NQS0; B8Y636
• Molecular Weight: 14 kDa (127 aa), confirmed by MALDI-TOF. (Molecular weight on SDS-PAGE will appear higher)
• NCBI Official Full Name: retinoic acid receptor alpha isoform 1
• NCBI Official Synonym Full Names: retinoic acid receptor alpha
• NCBI Official Symbol: RARA
• NCBI Official Synonym Symbols: RAR; NR1B1
• NCBI Protein Information: retinoic acid receptor alpha
• UniProt Protein Name: Retinoic acid receptor alpha
• Protein Family: Retinoic acid receptor
• UniProt Gene Name: RARA
• UniProt Synonym Gene Names: NR1B1; RAR-alpha
• UniProt Entry Name: RARA_HUMAN

NCBI Description

This gene represents a nuclear retinoic acid receptor. The encoded protein, retinoic acid receptor alpha, regulates transcription in a ligand-dependent manner. This gene has been implicated in regulation of development, differentiation, apoptosis, granulopoeisis, and transcription of clock genes. Translocations between this locus and several other loci have been associated with acute promyelocytic leukemia. Alternatively spliced transcript variants have been found for this locus.[provided by RefSeq, Sep 2010]

Uniprot Description

RARA: is a receptor for retinoic acid, a potent mammalian morphogen and teratogen that has profound effects on vertebrate development. RARA is a member of the nuclear receptor superfamily. Controls cell function by directly regulating gene expression. Its phosphorylation is crucial for transcriptional activity. Aberrations involving RARA may be a cause of acute promyelocytic leukemia. Two splice-variant isoforms have been described.

Protein type: Nuclear receptor; Transcription factor; Oncoprotein; DNA-binding

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: nucleoplasm; cell surface; cell soma; perinuclear region of cytoplasm; cytoplasm; nuclear chromatin; dendrite; nucleus; actin cytoskeleton

Molecular Function: protein domain specific binding; protein kinase B binding; retinoic acid binding; zinc ion binding; chromatin DNA binding; translation repressor activity, nucleic acid binding; transcription coactivator activity; drug binding; phosphoinositide 3-kinase regulator activity; alpha-actinin binding; transcription factor binding; protein binding; enzyme binding; protein heterodimerization activity; protein kinase A binding; steroid hormone receptor activity; mRNA 5'-UTR binding; retinoic acid receptor activity; transcription factor activity; transcription corepressor activity; receptor binding

Biological Process: prostate gland development; negative regulation of translational initiation; regulation of myelination; estrogen receptor signaling pathway; glandular epithelial cell development; positive regulation of transcription, DNA-dependent; regulation of synaptic plasticity; female pregnancy; protein amino acid phosphorylation; regulation of phosphoinositide 3-kinase activity; response to vitamin A; germ cell development; Sertoli cell fate commitment; positive regulation of T-helper 2 cell differentiation; positive regulation of cell cycle; positive regulation of phosphoinositide 3-kinase cascade; response to ethanol; positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling; negative regulation of transcription, DNA-dependent; negative regulation of apoptosis; limb development; retinoic acid receptor signaling pathway; ventricular cardiac muscle cell differentiation; negative regulation of transcription from RNA polymerase II promoter; signal transduction; response to estradiol stimulus; negative regulation of granulocyte differentiation; positive regulation of interleukin-4 production; negative regulation of cell proliferation; ureteric bud development; negative regulation of interferon-gamma production; positive regulation of cell proliferation; positive regulation of interleukin-13 production; transmembrane transport; positive regulation of interleukin-5 production; transcription initiation from RNA polymerase II promoter; response to retinoic acid; multicellular organism growth; positive regulation of binding; negative regulation of tumor necrosis factor production; liver development; embryonic camera-type eye development; positive regulation of protein kinase B signaling cascade; response to cytokine stimulus; neural tube closure; gene expression; spermatogenesis; positive regulation of neuron differentiation; apoptotic cell clearance

Disease: Acute Promyelocytic Leukemia