Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Fc receptor-like protein 2 (FCRL2) Recombinant Protein | FCRL2 recombinant protein

Recombinant Human Fc receptor-like protein 2 (FCRL2), partial

Gene Names
FCRL2; FCRH2; IFGP4; IRTA4; SPAP1; CD307b; SPAP1A; SPAP1B; SPAP1C
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fc receptor-like protein 2 (FCRL2); Recombinant Human Fc receptor-like protein 2 (FCRL2); partial; FCRL2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-401. Partial, provide the complete extracellular domain.
Sequence
LTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSVFKKFSDFLIQSAVLSDSGNYFCSTKGQLFLWDKTSNIVKIKVQELFQRPVLTASSFQPIEGGPVSLKCETRLSPQRLDVQLQFCFFRENQVLGSGWSSSPELQISAVWSEDTGSYWCKAETVTHRIRKQSLQSQIHVQRIPISNVSLEIRAPGGQVTEGQKLILLCSVAGGTGNVTFSWYREATGTSMGKKTQRSLSAELEIPAVKESDAGKYYCRADNGHVPIQSKVVNIPVRIPVSRPVLTLRSPGAQAAVGDLLELHCEALRGSPPILYQFYHEDVTLGNSSAPSGGGASFNLSLTAEHSGNYSCEANNGLGAQCSEAVPVSISGPDGYRRDLMTAGV
Sequence Length
401
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for FCRL2 recombinant protein
This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein has four extracellular C2-type immunoglobulin domains, a transmembrane domain and a cytoplasmic domain that contains one immunoreceptor-tyrosine activation motif and two immunoreceptor-tyrosine inhibitory motifs. This protein may be a prognostic marker for chronic lymphocytic leukemia. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,533 Da
NCBI Official Full Name
Fc receptor-like protein 2 isoform 2
NCBI Official Synonym Full Names
Fc receptor like 2
NCBI Official Symbol
FCRL2
NCBI Official Synonym Symbols
FCRH2; IFGP4; IRTA4; SPAP1; CD307b; SPAP1A; SPAP1B; SPAP1C
NCBI Protein Information
Fc receptor-like protein 2
UniProt Protein Name
Fc receptor-like protein 2
Protein Family
UniProt Gene Name
FCRL2
UniProt Synonym Gene Names
FCRH2; IFGP4; IRTA4; SPAP1; FcR-like protein 2; FcRL2; FcRH2

NCBI Description

This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein has four extracellular C2-type immunoglobulin domains, a transmembrane domain and a cytoplasmic domain that contains one immunoreceptor-tyrosine activation motif and two immunoreceptor-tyrosine inhibitory motifs. This protein may be a prognostic marker for chronic lymphocytic leukemia. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Apr 2009]

Uniprot Description

May have an regulatory role in normal and neoplastic B cell development.

Research Articles on FCRL2

Similar Products

Product Notes

The FCRL2 fcrl2 (Catalog #AAA1408788) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-401. Partial, provide the complete extracellular domain. The amino acid sequence is listed below: LTLVAPSSVF EGDSIVLKCQ GEQNWKIQKM AYHKDNKELS VFKKFSDFLI QSAVLSDSGN YFCSTKGQLF LWDKTSNIVK IKVQELFQRP VLTASSFQPI EGGPVSLKCE TRLSPQRLDV QLQFCFFREN QVLGSGWSSS PELQISAVWS EDTGSYWCKA ETVTHRIRKQ SLQSQIHVQR IPISNVSLEI RAPGGQVTEG QKLILLCSVA GGTGNVTFSW YREATGTSMG KKTQRSLSAE LEIPAVKESD AGKYYCRADN GHVPIQSKVV NIPVRIPVSR PVLTLRSPGA QAAVGDLLEL HCEALRGSPP ILYQFYHEDV TLGNSSAPSG GGASFNLSLT AEHSGNYSCE ANNGLGAQCS EAVPVSISGP DGYRRDLMTA GV . It is sometimes possible for the material contained within the vial of "Fc receptor-like protein 2 (FCRL2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.